KEGG   Methylocystis bryophila: B1812_06315Help
Entry
B1812_06315       CDS       T04837                                 

Definition
(GenBank) multidrug export protein EmrA
  KO
K03543  membrane fusion protein, multidrug efflux system
Organism
mbry  Methylocystis bryophila
Brite
KEGG Orthology (KO) [BR:mbry00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mbry02000]
    B1812_06315
Transporters [BR:mbry02000]
 Other Transporters
  Accessory factors involved in transport [TC:8]
   B1812_06315
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HlyD_D23 HlyD_3 Biotin_lipoyl_2 Tropomyosin_1 HlyD OEP HlyD_2
Motif
Other DBs
NCBI-ProteinID: ARN83436
UniProt: A0A1W6N0V8
LinkDB All DBs
Position
complement(1344049..1345047)
Genome map
AA seq 332 aa AA seqDB search
MILLLIGGGAYYWISSRNVESTDDAFTDGRAIAIAPQVAGQVDTLSVRDNQFVRKGDPLI
RINQRQFLIDRDSAKGALDTAKAQYQGFRYGAEIARKNFPAQLAQAQAQLANAQAVEARA
AADYQRQKSLPAKATTQQEIDAAAAALKQAKAQVALADAQVLQNQPVPQRIGEADTQVGQ
LEGQVQSAQARLDQANLNLAWTNVTAPQDGWVTKRNVEAGNYVTAGQQVMSIVSPEVWVT
ANFKENQLKRMRPGQKVDIEVDGYPQLKLKGHVDSIQLGAGSKFTAFPPENATGNFVKIV
QRVPVKIVIDSGLDPEVPLPLGISVTPKVFLK
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
ctgatcctgctcttgattggaggaggggcctattactggatctcgtcgcgcaacgtggaa
tccacggatgacgccttcaccgatggacgcgcgatcgccatcgcgccgcaagtcgcgggg
caagtcgacacgctgagcgtgcgggacaatcaattcgtccgcaagggcgatcccctgatt
cgcatcaaccaacgccaattcttgatcgaccgcgactcggccaagggcgccttggatacg
gcaaaggcgcaatatcaggggtttcgttacggcgccgagatcgctcgcaaaaatttcccc
gcccagctcgcgcaggcgcaagcgcagctcgctaacgctcaggctgtcgaggcgcgcgcc
gccgctgactaccagcgtcagaagagcctgcccgcgaaggcgacgacgcaacaagagatc
gacgccgcggcggccgccttaaagcaggcgaaagcgcaagtcgcgctcgctgacgcgcag
gtgctgcagaaccaacccgtgccgcagcgtatcggagaagcggatacgcaggtgggccag
ctcgaaggtcaggtgcaatcggcgcaagcccgactggatcaggccaatctcaatctggcc
tggacaaatgtcacggcgccgcaggacggctgggtgacgaagcgcaatgtcgaggcggga
aactatgtcacggccggtcagcaggtcatgtcgatcgtttctcccgaagtctgggtgacc
gcaaacttcaaggagaaccagctcaagcggatgcggcccggccagaaggtcgacatcgag
gttgacggctatccgcagctcaagctcaaaggtcatgtcgacagcattcagcttggcgct
ggctccaagttcaccgcctttccgcccgaaaacgcgaccggcaatttcgtcaagatcgtg
cagcgcgtccctgtcaagatcgtcatcgactccgggctcgatccggaggttcccctgccg
ctcggcatctcggtcacgcccaaggtcttcctcaaatga

DBGET integrated database retrieval system