KEGG   Methylocystis bryophila: B1812_13975Help
Entry
B1812_13975       CDS       T04837                                 

Definition
(GenBank) translation elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
mbry  Methylocystis bryophila
Brite
KEGG Orthology (KO) [BR:mbry00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:mbry03012]
    B1812_13975
   03029 Mitochondrial biogenesis [BR:mbry03029]
    B1812_13975
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mbry04147]
    B1812_13975
Translation factors [BR:mbry03012]
 Eukaryotic Type
  Elongation factors
   B1812_13975
 Prokaryotic Type
   B1812_13975
Mitochondrial biogenesis [BR:mbry03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    B1812_13975
Exosome [BR:mbry04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   B1812_13975
  Exosomal proteins of breast cancer cells
   B1812_13975
  Exosomal proteins of colorectal cancer cells
   B1812_13975
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: ARN82003
UniProt: A0A1W6MWM9
LinkDB All DBs
Position
2942916..2944106
Genome map
AA seq 396 aa AA seqDB search
MAKEKFSRTKPHCNIGTIGHVDHGKTSLTAAITKVLAETGGATFTAYDQIDKAPEERARG
ITISTAHVEYETSKRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHI
LLARQVGVPALVVFLNKVDMVDDPELLELVELEVRELLSKYEFPGDDIPITKGSALAALE
NKTPEIGHDAILALMKTVDDYIPQPERPKDQPFLMPVEDVFSISGRGTVVTGRIERGVIK
VGEEVEIVGIRPTSKSTVTGVEMFRKLLDQGEAGDNVGCLLRGTKREEVERGQVLCKPGT
VKPHTKFKAEAYILTKEEGGRHTPFFTNYRPQFYFRTTDVTGVVTLPEGVEMVMPGDNIS
MEVALIVPIAMEEKLRFAIREGGRTVGAGVVASIIE
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggccaaggaaaagttctcacgcacgaagccgcactgcaacattgggacgatcggtcac
gtggaccacggcaagacgtcgctgacggcggcgatcaccaaggttctggcggagacgggc
ggagcgacgttcacggcctacgatcagatcgacaaggctccggaggagcgggcgcgcggc
atcacgatctcgacggcgcatgtcgaatatgagacctcgaagcggcattacgcgcatgtc
gactgccccggccacgccgactatgtgaagaacatgatcacgggcgcggcgcagatggac
ggcgcgatcctggtggtttcggcggccgacggcccgatgccgcagacgcgcgagcacatc
cttctggcgcgccaggtcggcgttccggcgcttgtggtgttcttgaacaaggtcgacatg
gtcgacgatccggagcttctcgagctcgtggagctcgaagtgcgcgagctgctcagcaaa
tatgagttcccgggcgacgacattccgatcaccaagggctcggcgctggcggcgctggag
aacaagacgcccgagatcggccatgacgcgatcctcgcgctgatgaagacggtcgacgac
tatattccgcagccggagcgtccgaaggatcagcccttcctgatgccggtggaagacgtg
ttctcgatctcgggccgcggcacggtggtgacggggcgcattgagcgcggcgtgatcaag
gtcggcgaggaagtggagatcgtgggcatccgtccgacgtcgaagtcgacggtgacgggc
gtcgagatgttccgcaagctgctggaccagggcgaggcgggcgacaacgtgggttgcctg
ctgcgcggcacgaagcgcgaggaagtggagcgcggacaggttctgtgcaagcccggcacg
gtgaagccgcacacgaagttcaaggcggaagcctacatcctgacgaaggaagagggcggg
cgtcacacgccgttcttcacgaattaccgtccgcaattctacttccgcacgacggacgtg
acgggcgtggtgactctgccggaaggcgttgagatggtgatgccgggcgacaacatctcg
atggaggtggcgctgatcgttccgatcgccatggaggagaagctgcgcttcgccatccgc
gaaggcggcagaaccgtcggcgccggcgtcgtcgccagcatcatcgaataa

DBGET integrated database retrieval system