KEGG   Methylocystis bryophila: B1812_19435Help
Entry
B1812_19435       CDS       T04837                                 

Definition
(GenBank) hypothetical protein
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
mbry  Methylocystis bryophila
Pathway
mbry00500  Starch and sucrose metabolism
mbry01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mbry00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    B1812_19435
Enzymes [BR:mbry01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     B1812_19435
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_15 Hemerythrin
Motif
Other DBs
NCBI-ProteinID: ARN82888
UniProt: A0A1W6MZ90
LinkDB All DBs
Position
complement(4088539..4090005)
Genome map
AA seq 488 aa AA seqDB search
MKKVQPQEQLDWASEQKRFCVSAMLRAVSATTLVKHRPGLGQTIRPVRGSILASPEMASY
DPKPDYFFHWLRDSALVADALREAIEDETLEPSGVEHLVDFVAFSLKLCRLDGPTFLRQG
GYPEAVEQSFQQHLRPRAEIGAIVGDKILGEARHNADGGLDVMKWGRPQNDGPALRALAV
MRFFALDAFRARAAEAALTLLRYDLDYTLSHWRLPCCDLWEENIGFHYHTRLVQQAALAE
GAAFLAAAGDAKRASACAKAASALLAALDSHFDAEDGVYRPRLPEDGLNASALRRLDIAV
VLAAIHAGRRAGPHSVTDPKMLATFFALERLFEEEYPINQGRPADRAPALGRYAGDSYFS
GGAYYFSTLGAAQFCFLLAQAAAEGEEIAVTKESRAPLAAILQTPAAALPQAGKIGEALA
EAALRRGDMYLATVRRFTPASRELSEQFSQLDGAPTSADNLTWSYACFVTALAARQRAAK
AMGDARVS
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaggtgcagcctcaggaacagctcgactgggccagcgagcagaaacgcttttgc
gtgagcgcgatgctgcgcgccgtctctgcgacgaccctcgtgaagcatcggcccggactc
gggcagaccattcgccccgtgcgcggctcgatactcgcctcgcccgaaatggcgtcctac
gaccccaagccggattatttcttccactggctgcgcgactccgcccttgtcgccgacgcg
cttcgggaggcgatcgaggatgaaacgctggagccttctggtgtcgagcatctcgtcgat
ttcgtcgctttcagcctgaaactctgtcgcctggacggccctaccttcctgcgacagggc
ggctatcccgaggccgtcgagcaatctttccaacagcatttgcgcccacgcgcggaaatt
ggcgcaatcgtcggcgacaagatactcggcgaagcccgccacaacgccgatggcggactc
gatgtgatgaaatggggtcgcccccaaaacgacggcccggcgctgcgcgcgctcgccgtt
atgcgtttcttcgcgctcgacgcctttcgcgcccgggcggcggaggcggcgctgacgctc
ttgcgctacgatctcgactatacgctctcgcattggcgtctgccttgctgcgacctctgg
gaagaaaacatcggcttccattaccacacgcgcctcgttcagcaggcggcgctcgccgaa
ggcgcggcgtttttggccgcagcgggcgacgcgaagcgagcgagcgcctgcgccaaggcg
gccagtgctttgctcgccgcgctcgattctcacttcgatgcggaagacggcgtctatcgc
ccgcgcctccccgaagacgggctgaacgcatcggcgctgcggcgactcgacatcgccgtc
gttctcgcggcgatccatgcaggccggcgggcggggccccacagcgtcacggatcccaaa
atgctggcgaccttttttgcgctggagcggctgttcgaggaggaatatccgatcaatcag
gggcggcctgcggaccgcgcgccggcgctcgggcgctatgccggcgacagctatttcagc
ggcggcgcctattatttctcaaccctgggcgccgcgcaattttgctttctcctcgcgcag
gccgcagcggaaggcgaggagatcgcagtcaccaaggaaagtcgcgcgccgctcgcagcg
atattgcagacgcccgccgccgcgctcccgcaggctggaaaaatcggtgaggctttggcc
gaggcggcgcttcggcgcggcgacatgtatctcgccacagtgcgccgcttcacgccggcc
tcacgagaactctcggaacaattcagccaactggacggcgccccgacctccgccgacaat
ctcacatggagctacgcctgcttcgtcacggcgctcgccgcgcgccaacgagcggcgaaa
gccatgggggacgcgcgggtgagctga

DBGET integrated database retrieval system