KEGG   Methylocystis bryophila: B1812_20455Help
Entry
B1812_20455       CDS       T04837                                 

Definition
(GenBank) 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
mbry  Methylocystis bryophila
Pathway
mbry00061  Fatty acid biosynthesis
mbry00780  Biotin metabolism
mbry01100  Metabolic pathways
mbry01212  Fatty acid metabolism
Module
mbry_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:mbry00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    B1812_20455
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    B1812_20455
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:mbry01004]
    B1812_20455
Enzymes [BR:mbry01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     B1812_20455
Lipid biosynthesis proteins [BR:mbry01004]
 Fatty acid synthase
  Component type
   B1812_20455
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA 4HBT MaoC_dehydratas
Motif
Other DBs
NCBI-ProteinID: ARN83061
UniProt: A0A1W6MZQ0
LinkDB All DBs
Position
4315671..4316138
Genome map
AA seq 155 aa AA seqDB search
MNQAATGAKLDSVDILGILELLPHRYPFLLIDRVVDIRGDEYGVGIKNVTMNEPQFQGHF
PERPVMPGVLMIEAMAQTAGVIAIHAHKGNGSRPKSVYFVTIDKAKFRKPVGPGDRLELR
MTKTAHKRNIFWYRGEGVVDGALVCEAEISAMLGT
NT seq 468 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaggccgccacgggcgcgaagctcgattccgtcgatattttggggattctcgag
ctgttgccgcatcgctatccctttctcttgattgatcgcgttgtcgatatccgcggcgac
gaatacggcgtcgggatcaagaacgtcacgatgaacgagccgcagttccagggccatttc
cctgaacggccggtcatgccgggcgttctgatgatcgaggcgatggcgcagacagcgggc
gtcatcgcgatccatgcccataagggcaatgggtcgcgtccgaagagtgtctatttcgtg
acgatcgacaaggcgaagttcagaaagcccgttgggcccggcgatcggctcgagctgcgc
atgaccaagaccgcgcacaagcgaaacatcttctggtatcgcggcgagggcgtcgtcgac
ggcgcgctcgtctgcgaggccgagatcagcgccatgctcgggacctga

DBGET integrated database retrieval system