KEGG   Marinobacter sp. BSs20148: MRBBS_0106Help
Entry
MRBBS_0106        CDS       T02323                                 

Gene name
icd2
Definition
(GenBank) Isocitrate dehydrogenase [NADP] 2
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
mbs  Marinobacter sp. BSs20148
Pathway
mbs00020  Citrate cycle (TCA cycle)
mbs00480  Glutathione metabolism
mbs01100  Metabolic pathways
mbs01110  Biosynthesis of secondary metabolites
mbs01120  Microbial metabolism in diverse environments
mbs01130  Biosynthesis of antibiotics
mbs01200  Carbon metabolism
mbs01210  2-Oxocarboxylic acid metabolism
mbs01230  Biosynthesis of amino acids
Module
mbs_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mbs_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:mbs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MRBBS_0106 (icd2)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    MRBBS_0106 (icd2)
Enzymes [BR:mbs01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     MRBBS_0106 (icd2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IDH
Motif
Other DBs
NCBI-ProteinID: AFP29044
UniProt: M1FB22
LinkDB All DBs
Position
114316..116556
Genome map
AA seq 746 aa AA seqDB search
MSESITKIIYTLTDEAPALATRSLLPILKTYAKPAGIHFETSDISLAARILANFPDYLAE
DQRVPDALAELGEYTKDPNANIIKLPNISASIPQLRSAIKELNKQGYKVPEYEENPQTDE
EKDVTSRYSKVLGSAVNPVLREGNSDRRAPAAVKAFARKYPHSMGEWSPASRTHVAHMKG
GDFYSSEQSVTLDKATNSRIVFENKKGEQTVLKAELPLLDGEVVDGMNMSKKALCAFFEA
AIKDCEDTGVMFSLHVKATMMKISHPIVFGHAVKIYYKELFDQFGDLFDEIGVNPNNGLS
SVLEKIKLLPESKQEEIQEALHKTYEHRPEIAMVDSVKGITNLHMPSDIIVDASMPAMIR
NSGKMWARDGKLKDTKAVMPESTYATIYQEAINFCKTNGAFDPTTMGTVPNVGLMAQKAE
EYGSHDKTFEIKEDGIIRVIAEDGTVLTEHNVETGDIWRACQTKDLPIRDWVKLAVNRAR
ATGMPAVFWLDDERAHDAQLIKKVNTYLKDHDTDGLDIRIMSPVRAIRWTMERLIRSLDT
ISVTGNVLRDYLTDLFPILELGTSAKMLSIVPLLNGGGLYETGAGGSAPKHVQQLVEENH
LRWDSLGEFLAIAVSLDELGAKHNNHRARLLGQTLDKATETLLENNQSPSRSTGELDNRG
SHFHLAYYWAQELAAQDEDKELKSFFAKLAEKLGAQKDKILEELTAIQGKAVDLGGYFHA
PAGRVTEVMQPSATLNKLMEEALASA
NT seq 2241 nt NT seq  +upstreamnt  +downstreamnt
atgtcagagtcaataaccaaaattatctacacactgaccgacgaagcgccagcgcttgcc
acccggtcactgctgccgatcttgaagacctacgccaagccggctggcattcattttgaa
accagcgatatttcattggcggcccgtatcctggccaacttcccggactacctcgcagaa
gaccagcgcgtgcccgatgctttggccgaactgggtgaatacaccaaagatcctaacgcc
aacatcattaaattgccgaacatttccgcctctatcccgcagctgcgctctgccatcaaa
gagttgaacaagcagggttataaggtcccggaatatgaagaaaatccccagactgacgaa
gaaaaagatgtcacctcccgttatagcaaagtactgggcagcgctgtaaacccggtattg
cgtgagggcaactctgaccgccgtgctcctgccgcggtaaaagcctttgcccgcaaatac
ccgcactccatgggcgagtggagccctgcatcgcgcacccacgtagcgcacatgaaaggc
ggcgacttctactcttcagagcagtccgtcactctggacaaggctaccaacagccgcatc
gtgttcgagaataagaaaggcgaacagaccgtgctgaaagccgaactgccgctgctggac
ggcgaagtggtcgacggcatgaacatgagtaaaaaagcgctgtgtgcattcttcgaagcg
gctattaaagactgtgaagacaccggcgtgatgttttctctgcatgttaaagccaccatg
atgaaaatttcccacccgatcgtgtttggtcatgcggtgaagatttactacaaagaactg
tttgaccagtttggcgacttgttcgacgagatcggcgtaaacccgaacaacggtttgtca
tctgtgctcgagaaaatcaagctactaccagagtcgaagcaggaagaaattcaggaagca
ttgcacaaaacctacgagcatcgtccggaaatcgctatggtggactcggtcaaaggtatc
accaacctgcacatgcccagtgacattatcgtagacgcctccatgcctgcgatgatccgc
aactccggcaaaatgtgggcccgtgatggcaagctgaaagacaccaaagcggtaatgcca
gagtcgacttacgccactatttaccaggaagccatcaacttttgtaaaaccaacggcgcg
tttgaccccactaccatgggcaccgtaccaaacgtgggtctgatggcgcagaaggccgaa
gagtacggctcacacgacaagacgtttgaaattaaagaagacggcattattcgggtgatc
gccgaagacggcaccgtactgaccgagcacaacgtggaaaccggcgacatctggcgcgca
tgccagactaaagacctgcccattcgcgactgggtcaaactggccgttaatcgtgcccgg
gccaccggcatgccggctgtgttctggctggacgacgagcgtgcccacgacgcccagttg
atcaagaaagtaaacacttacctgaaagaccacgacaccgatggtctggacatccgcatc
atgtcgccggtacgtgctattcgctggaccatggagcgcctgattcgcagcctggatacc
atttcggtaaccggcaacgtattgcgtgactacctgacggacctgttcccgattctggag
ttgggcaccagcgccaaaatgctgtccatcgtaccgctgctgaacggcggtggtctgtac
gaaaccggtgctggcggttctgcgccgaagcacgtgcagcaactggtcgaagaaaaccac
ctgcgctgggactcattgggtgagttcctggccatcgcggtatcgctggacgagctgggt
gcaaagcacaataaccaccgtgcacgtctgctgggtcagaccttggacaaagccaccgag
acactgctggaaaacaaccagtcaccgtcgcgctctaccggcgaactggacaaccgtggc
agccacttccacctggcttattactgggcacaggaactggctgctcaggacgaagataag
gaactgaaatccttcttcgccaagctggctgaaaagctgggagcccaaaaagacaagatc
cttgaagagctgacagcgattcagggcaaagcagtggatctgggaggctactttcacgcg
cctgctggcagagtaaccgaagtcatgcagcccagtgcaacgctaaacaagctgatggaa
gaagccctcgcctcggcttaa

DBGET integrated database retrieval system