KEGG   Marinobacter sp. BSs20148: MRBBS_3202Help
Entry
MRBBS_3202        CDS       T02323                                 

Gene name
fabA
Definition
(GenBank) 3-hydroxydecanoyl-[acyl-carrier-protein] dehydratase
  KO
K01716  3-hydroxyacyl-[acyl-carrier protein] dehydratase / trans-2-decenoyl-[acyl-carrier protein] isomerase [EC:4.2.1.59 5.3.3.14]
Organism
mbs  Marinobacter sp. BSs20148
Pathway
mbs00061  Fatty acid biosynthesis
mbs01100  Metabolic pathways
mbs01212  Fatty acid metabolism
Module
mbs_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:mbs00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    MRBBS_3202 (fabA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:mbs01004]
    MRBBS_3202 (fabA)
Enzymes [BR:mbs01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     MRBBS_3202 (fabA)
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.14  trans-2-decenoyl-[acyl-carrier protein] isomerase
     MRBBS_3202 (fabA)
Lipid biosynthesis proteins [BR:mbs01004]
 Fatty acid synthase
  Component type
   MRBBS_3202 (fabA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA
Motif
Other DBs
NCBI-ProteinID: AFP32138
UniProt: M1FLQ4
LinkDB All DBs
Position
3357992..3358516
Genome map
AA seq 174 aa AA seqDB search
MDSNPYPNTFSKQDLIDCGHGELFKGAGMRLPIDEMLMFDRITHIGNEGGLYGKGGLTAE
LDINPDLWFFKVHFDSDPVMPGCLGLDAMWQLLGFYLAWTGGKGKGRALGSGQVKFFGQV
LPNAKKVTYHLDFKRLIKRKLTMAIADGRMEVDGKEIYTAKDLRVGLFTSTDNF
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
atggattccaacccgtaccccaacacgtttagcaaacaagacctgatcgactgcggtcac
ggtgaattgttcaagggcgctggcatgcgcctgcccattgatgaaatgctgatgttcgac
cgcatcacccacattgggaacgaaggtgggctttacggcaaaggtggcctgaccgcagag
ctggatatcaacccggacctgtggttcttcaaggtgcactttgacagcgatcccgttatg
ccgggttgcctgggccttgacgccatgtggcagctgctcggtttctacctggcatggacc
ggtggcaagggcaaaggccgcgcgctgggttccggtcaagtgaaattctttggccaggtt
cttcctaatgccaaaaaagtcacttaccatcttgacttcaaacgtcttataaagcgtaag
ttaaccatggctatcgctgatggccgcatggaagtggacggcaaggaaatttatacggcc
aaagacctacgggtaggcctgttcacttccaccgacaatttttag

DBGET integrated database retrieval system