KEGG   Marinobacter sp. BSs20148: MRBBS_3203Help
Entry
MRBBS_3203        CDS       T02323                                 

Gene name
fabB
Definition
(GenBank) 3-oxoacyl-[acyl-carrier-protein] synthase 1
  KO
K00647  3-oxoacyl-[acyl-carrier-protein] synthase I [EC:2.3.1.41]
Organism
mbs  Marinobacter sp. BSs20148
Pathway
mbs00061  Fatty acid biosynthesis
mbs00780  Biotin metabolism
mbs01100  Metabolic pathways
mbs01212  Fatty acid metabolism
Module
mbs_M00083  Fatty acid biosynthesis, elongation
mbs_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:mbs00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    MRBBS_3203 (fabB)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    MRBBS_3203 (fabB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:mbs01004]
    MRBBS_3203 (fabB)
Enzymes [BR:mbs01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.41  beta-ketoacyl-[acyl-carrier-protein] synthase I
     MRBBS_3203 (fabB)
Lipid biosynthesis proteins [BR:mbs01004]
 Fatty acid synthase
  Component type
   MRBBS_3203 (fabB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ketoacyl-synt Ketoacyl-synt_C Thiolase_N KAsynt_C_assoc
Motif
Other DBs
NCBI-ProteinID: AFP32139
UniProt: M1FIE9
LinkDB All DBs
Position
3358528..3359739
Genome map
AA seq 403 aa AA seqDB search
MRRVVITGMGIVSSLGTDIKAVTKSLREVKSGIGFSEEARDNGLRSQICGQINLNLPELI
DRKLWRFMCPASGYAHLSTVEALAQSGLTDEQIRANTTGAIFGTGGASTVELMDAIDTHR
AKGIRRVGPYRVPRTMGSSINASIATAFGITGVNYGVTSACATSTHAIGHAADLIAMGRQ
DVMLAGGGDDIHWSLSMLFDAMGALSTKYNDTPEKASRTYDANRDGFVISGGGGTLVLES
LEHAQARGANILAEIVGFGATSDGADMVAPSGEGAVRCMQQAMKNIDGEISYINTHGTST
TAGDITELKAIKQAFGDRIPPLSSTKALSGHALGAAGVHEAIYSLIMQRENFICPSANIE
NLDEGAEGYPVVREVRENQNLEYVMSNSFGFGGTNGSLVFKKF
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcgcgttgtaatcactgggatgggcattgtgtccagccttggaaccgacataaag
gctgtaaccaaatcactgcgggaagtaaagtccggtatcggcttcagcgaagaagcccgt
gataatggcctacggagccagatttgcggtcagatcaacctgaaccttccagaattgatt
gaccgcaagctgtggcgctttatgtgcccggcctccggctacgcccacctgtcgacggta
gaagctctggcccagtccggcctgaccgacgagcagatccgcgccaacaccaccggagct
atttttggcaccggtggcgcatctaccgtggagctgatggacgccatcgacacccatcgt
gcaaaaggcattcgccgggtgggcccttaccgggtgccacgcaccatgggcagctctatc
aatgccagcattgctacggcgttcggcatcaccggtgttaactacggcgttacgtcggcc
tgtgctaccagtacccacgcgattggccacgctgcagacttgattgctatgggccgccag
gacgtcatgctggcgggcggtggcgacgacatccactggagcctgagcatgttgttcgac
gccatgggcgcgctgtccaccaagtacaacgacaccccggagaaagcgtcgcgcacctac
gatgctaaccgtgacggtttcgtgatttctggcggcggcggcaccctggtgctggaatct
ctggaacacgcacaagcccgcggcgccaacatcctggcggaaatcgtcggctttggcgca
acctctgatggcgccgatatggtcgcccccagcggcgagggtgcagtacgctgcatgcag
caggcgatgaaaaacatcgacggcgaaatcagctacatcaacacccacggcaccagcaca
acagccggcgacatcaccgagctgaaagctatcaagcaggcctttggagaccgcattccg
ccgctgagctctaccaaagcactgagcggccacgctctgggcgcggcaggcgtgcacgaa
gccatttacagcctgatcatgcagcgtgaaaactttatttgcccatcagccaacatcgaa
aacctggatgaaggcgcagaaggttacccggtcgtgcgcgaagtgcgcgaaaaccagaac
ctggaatatgtgatgagcaatagtttcggctttggcggcaccaacggcagcctggtgttc
aaaaagttctaa

DBGET integrated database retrieval system