KEGG   Marinobacter sp. BSs20148: MRBBS_3537Help
Entry
MRBBS_3537        CDS       T02323                                 

Gene name
trpE
Definition
(GenBank) Anthranilate synthase component 1
  KO
K01657  anthranilate synthase component I [EC:4.1.3.27]
Organism
mbs  Marinobacter sp. BSs20148
Pathway
mbs00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mbs01100  Metabolic pathways
mbs01110  Biosynthesis of secondary metabolites
mbs01130  Biosynthesis of antibiotics
mbs01230  Biosynthesis of amino acids
mbs02024  Quorum sensing
Module
mbs_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mbs00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    MRBBS_3537 (trpE)
  09110 Biosynthesis of other secondary metabolites
   00405 Phenazine biosynthesis
    MRBBS_3537 (trpE)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    MRBBS_3537 (trpE)
Enzymes [BR:mbs01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.27  anthranilate synthase
     MRBBS_3537 (trpE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Chorismate_bind Anth_synt_I_N
Motif
Other DBs
NCBI-ProteinID: AFP32473
UniProt: M1FMB5
LinkDB All DBs
Position
3699885..3701372
Genome map
AA seq 495 aa AA seqDB search
MTPENFRELAQAGYNRIPVYREVLADMDTPLSTYLKLASGPYSYLFESVQGGEKWGRYSI
IGLPSQEVLKVFDHRIEIRRHGELVESSEVKDPLAFIASYQERFHAPDLVELPRFNGGLV
GYFGYDTVRYIEKRLASSCPPDRIGTPDILLMVSNELVVFDNLRGKLHLIVHVNPANEGA
FEQAQKRLDQLEQQLRQNTAQTPKTPTHLRGKTVDESEFVSGFSQEKFEAAVDTIKDYVL
DGDVMQTVISQRMSIPFEAPPLNLYRSLRIMNPSPYMYFLDLDDFHIVGSSPEILARMED
REVTVRPIAGTRKRGATEAEDRALEAELLADPKEIAEHLMLIDLGRNDAGRVSETGTVRL
TEKMAVERYSHVMHIVSNVTGQVKDGISCLDVLKATLPAGTLSGAPKTRAMEIIDELEPV
KRGVYGGAVGYLSFNGNMDTAIAIRTAVIKDNTLHIQAGAGIVADSVPRLEWKETMNKGR
AIFRAVAMTYNDFDH
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgacccccgaaaatttccgcgagctggcacaagccggctacaaccgtatccccgtgtac
cgtgaagtactggcggatatggacaccccgttaagcacctatctaaaactggctagcggg
ccctattcctacctgtttgaatccgttcagggtggagaaaaatggggccgttattcgatc
atcggcctgcccagccaggaagtgctgaaagtcttcgatcaccgtatcgaaatccgtcgc
catggcgagctggtagaaagcagcgaagtaaaagacccactggccttcatcgccagctat
caggaacgtttccacgcccctgatctggttgaactgccgcgtttcaacggtggcttggtg
ggctattttggctacgataccgttcgctacattgaaaagcgtttggccagcagctgcccg
ccagaccgcattggcacaccggacatcctgctaatggtgtctaacgaactggtggtgttc
gacaacctgcgcggcaaactgcacctgattgttcacgtaaacccggccaacgaaggcgcc
tttgaacaggcccagaagcgcctggatcaactggaacagcagttacgccaaaacaccgct
caaacaccaaaaaccccgactcatctgcgcggcaaaaccgtggatgaaagcgagttcgtg
tccggcttcagccaagaaaaattcgaagccgccgtggacaccatcaaggactacgtactg
gatggcgacgtgatgcaaaccgtcatttcccaacgcatgtcgattccgtttgaggcgccg
ccgctgaatctgtaccgctcgctgcgaataatgaatccctcgccgtacatgtactttctg
gacctggacgattttcacattgtgggttcgtcaccggaaattctggcgcgaatggaagac
cgcgaagtgaccgtgcggcccatcgccggcacccgcaaacgcggcgcgaccgaagctgaa
gaccgcgccctggaagccgaactgctggctgacccaaaagaaattgccgagcacctgatg
ctgattgacttgggccgcaacgacgcgggccgggtatcggaaaccggcaccgtaagactg
accgagaaaatggcggttgagcgctactcccatgtaatgcacatcgtatcgaacgtcacc
ggccaggtaaaagacggcatcagctgccttgatgtcctaaaagccactctgcctgccggc
acattaagcggcgcaccaaaaacccgtgccatggaaatcattgacgagctggagccggtc
aaacgcggcgtgtatggcggcgccgtgggctatttgtcgttcaacggcaatatggacacc
gccatcgccatccgcaccgcggtgatcaaagacaacaccctgcacatacaggccggcgcc
ggtatagtcgcagattctgtaccacgcctggaatggaaagaaaccatgaacaaaggccgc
gccattttccgcgccgtcgccatgacctacaacgactttgaccactaa

DBGET integrated database retrieval system