KEGG   Marinobacter sp. BSs20148: MRBBS_3581Help
Entry
MRBBS_3581        CDS       T02323                                 

Definition
(GenBank) Glutamate decarboxylase and related PLP-dependent protein
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
mbs  Marinobacter sp. BSs20148
Pathway
mbs00250  Alanine, aspartate and glutamate metabolism
mbs00410  beta-Alanine metabolism
mbs00430  Taurine and hypotaurine metabolism
mbs00650  Butanoate metabolism
mbs01100  Metabolic pathways
mbs01110  Biosynthesis of secondary metabolites
mbs01120  Microbial metabolism in diverse environments
mbs02024  Quorum sensing
Module
mbs_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:mbs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    MRBBS_3581
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    MRBBS_3581
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MRBBS_3581
   00430 Taurine and hypotaurine metabolism
    MRBBS_3581
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    MRBBS_3581
Enzymes [BR:mbs01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     MRBBS_3581
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: AFP32517
UniProt: M1FJ10
LinkDB All DBs
Position
3741270..3742925
Genome map
AA seq 551 aa AA seqDB search
MTGIKKSAQASVEAMYRVFTIPEAPDSTLSRIDQDISRNLAGFLQDHIVAVERDLADVEK
NFSEYSVPEKPIFVSEQTQFLLDKLVANSVHTASPAFIGHMTSALPYFMLPLSKIMIALN
QNLVKTETSKAFTPLERQVLGMIHRLVFEQDGSFYRKWMHNPRYALGAMCSGGTVANLTA
LWVARNHAFPAEGNFRGLQQEGLFRALKYYGYEGAAIVVSRRGHYSLSKAADVLGLGRDA
LVTVATDSNNRIQIDALREKCLQLQKQKIKVIALCGVAGTTETGNVDPLEAMADIAREFG
AHFHVDAAWGGPTLFSRRYRSLLKGIEKADSVTFDAHKQLYVPMGVGLVVFRDPSLASAV
EHHAQYVIRKGSRDLGSTTLEGSRPGMAMLIHSGLKILAREGYELLIDTGIGKARTFAAM
IDEAEDFELITRPELNILTYRYCPAQVRQTLESADEMLAEKINTSLNRVTKFIQKTQRER
GKAFVSRTRLEPDNYYNFPCIVFRVVLANPLTTADILSDILTEQRLLAGEDGIADEMAIL
NNLATGARAHA
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atgaccggaattaaaaaatccgcccaggcctctgtagaggcaatgtatcgtgttttcacg
attcctgaggcacccgattctaccctgagccggattgaccaggatatatcccgtaatctt
gccggttttcttcaggatcacattgttgcggtagagcgtgacctggctgacgttgagaaa
aatttctccgaatacagcgtgccagaaaagcccatttttgtgtctgagcaaacccagttc
ctactcgacaaactggtggcgaactcggtacacaccgcatcacctgcttttattggccat
atgacgtcggcactgccctatttcatgctgccgctgtcgaagatcatgattgccctgaac
cagaatctggtgaaaaccgaaacctccaaggcgtttacacccctggagcgccaagtgctg
ggcatgattcatcggctggtattcgaacaagacggttcgttctaccgcaagtggatgcac
aacccccgctacgcgctgggcgccatgtgttccggcggcaccgttgccaacctgactgcg
ctgtgggtagcccgcaaccacgcatttccggcggaaggtaacttccgcggtttgcaacag
gaaggcctgttccgcgctttgaaatattacggctacgaaggcgccgctattgttgtgtcg
cgccgcggccattattccctgagcaaagccgccgacgtattgggcctgggccgagatgca
ctggtgactgtggcaaccgacagcaacaaccgtatccagattgatgcgttgcgggaaaaa
tgcctgcaattgcagaaacagaagatcaaggtaattgctctctgtggcgttgccggcacg
accgaaaccggcaacgtagatccgctggaagcgatggccgatatcgcccgcgaattcggc
gcacacttccacgtagatgccgcttggggtgggccaaccctgttttcgcgacgctatcgt
tcgctgctaaaaggcattgagaaagccgactcggtcacctttgacgcccataaacagctt
tacgtgcccatgggcgttggtttggtggtgttccgcgaccccagcctggccagtgcggtt
gaacaccacgctcagtacgtgatccgcaaaggctcgcgggatttgggcagcaccacgctt
gaaggctcgcgccctggcatggccatgctgattcactcaggcctgaaaattctggcacgc
gaaggttatgaactgcttattgacactggcattggcaaagcccgcacttttgcggccatg
attgatgaggcagaagattttgagctgatcacccggcctgagctgaacattctgacctat
cgctattgcccagctcaggtccggcagactctggaaagcgccgatgaaatgctggcggaa
aaaatcaacaccagcctgaaccgcgtcaccaagtttatccagaaaacccagcgtgaaagg
ggtaaagcgtttgtctcccgcactcgtctggaaccggacaactattacaactttccctgc
attgtattccgcgtggtgctggctaacccgctgaccaccgccgacatactgtcggacatt
ctgacagagcaacggctgctggccggcgaagacggtattgccgatgaaatggcaattctt
aacaacctggccacaggcgccagggcacacgcctaa

DBGET integrated database retrieval system