KEGG   Marinobacter sp. BSs20148: MRBBS_3629
Entry
MRBBS_3629        CDS       T02323                                 

Gene name
ygdH
Definition
(GenBank) LOG family protein ygdH
  KO
K06966  pyrimidine/purine-5'-nucleotide nucleosidase [EC:3.2.2.10 3.2.2.-]
Organism
mbs  Marinobacter sp. BSs20148
Pathway
mbs00230  Purine metabolism
mbs00240  Pyrimidine metabolism
mbs01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mbs00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    MRBBS_3629 (ygdH)
   00240 Pyrimidine metabolism
    MRBBS_3629 (ygdH)
Enzymes [BR:mbs01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.10  pyrimidine-5'-nucleotide nucleosidase
     MRBBS_3629 (ygdH)
    3.2.2.-  
     MRBBS_3629 (ygdH)
SSDB
Motif
Pfam: DUF3412 DUF4478 Lysine_decarbox LDcluster4
Other DBs
NCBI-ProteinID: AFP32565
UniProt: M1FGX8
LinkDB
Position
3792231..3793610
AA seq 459 aa
MNEPTINALVSPEGSLEILSNHEVNRLKDRSEGGLYRLFRQCALAVLNTGAVTDDCQDLM
TAHSDFEVHLVPQPRGLKLELINAPHHAFVDNEMLRANREHLFSVLRDIVYTHSSPLFIE
ANRHPRPEDLTNMVFHILRNARVLKPGRQPDMVVCWGGHSISHEEYQYSKEVGHQLGLRE
LSICTGCGPGAMKGPMKGATIGHAKQRVKDGRYIGITEPGIIGAEAPNPIVNELVIMPDI
EKRLEAFVRLGHGVIVFPGGVGTAEEILYLLGILLHPDNADIPFPVVFTGRRENADYFEM
IDKFIRNALGDDAAKRYEIIIDDPVRVARTMKLGMQEVETFRRAMQDAYYFNWTLKIDPV
FQLPFEPDHANMRALELHRDQPVHLIAANLRKAFSGIVAGNVKEEGIQKVSAHGPFEIAG
DPSLIKPLEAMLEQFVAQNRMKLPGTSAYRPSYRIISKA
NT seq 1380 nt   +upstreamnt  +downstreamnt
atgaatgaacccaccatcaacgcgttggtgtcgcccgaaggcagcctcgaaatcctgtct
aaccatgaagtaaaccgcctgaaagaccgcagcgaaggcggcctttaccggctgttccgc
cagtgcgcactggccgtgctgaacaccggagcggttaccgacgattgccaggatttgatg
acggcccacagcgactttgaggtgcacctggttccccagccccgcggcctgaaactggaa
ctgatcaatgcacctcaccatgcctttgtcgacaatgaaatgctgcgtgccaatcgcgaa
catttattttcggtgttgcgcgacatcgtatacacccattccagcccgctgttcattgaa
gccaaccggcatccgcggccggaagatctgaccaatatggtgtttcacattctgcgcaac
gcgcgcgtgctgaaaccggggcgacagccagacatggtggtgtgttggggtggccattcc
atcagccatgaagaataccaatacagcaaagaagtgggccatcagttgggcctgcgtgaa
ctgagcatttgcaccggctgcggccccggcgccatgaagggcccgatgaaaggcgccacc
ataggccacgccaagcagcgggtaaaagacggtcgctacattggcattaccgaacccggc
ataatcggcgccgaggcacccaatccgattgtgaacgaactggtgatcatgccggatata
gaaaaacgcctggaagcctttgtgcgccttggccacggcgtgattgtattccccggtggt
gtgggcacagcggaagaaattctttacctcttgggtattctgttgcacccagacaacgcc
gatattcccttcccggtggtgtttaccggcaggcgcgagaacgctgattattttgaaatg
atcgacaagtttatccgcaacgccctaggtgacgacgccgcgaagcgctatgaaattatc
atcgacgatccggtgcgggtagcgcgcaccatgaaactcggcatgcaagaggtcgaaacc
ttccgccgcgccatgcaagacgcctattactttaattggacgttaaaaatagaccctgtg
tttcagctgccatttgagccggaccacgccaacatgcgcgccttggaactgcatcgcgat
cagccagtgcacttgattgcggcaaatctgcgcaaagccttcagcggtattgttgcgggt
aacgtaaaagaagaaggaattcaaaaggtgagtgcacatggcccgttcgaaattgcgggc
gatcccagcctgattaagcctttggaagccatgctggaacagtttgtggctcaaaaccgg
atgaaactacccggcacctcggcttataggccaagttaccggattatcagcaaggcttaa

DBGET integrated database retrieval system