KEGG   Marinobacter sp. BSs20148: MRBBS_3723Help
Entry
MRBBS_3723        CDS       T02323                                 

Gene name
ahpF
Definition
(GenBank) Alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
mbs  Marinobacter sp. BSs20148
Brite
KEGG Orthology (KO) [BR:mbs00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    MRBBS_3723 (ahpF)
Enzymes [BR:mbs01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     MRBBS_3723 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA FAD_binding_2 FAD_oxidored DAO HI0933_like FAD_binding_3 Glutaredoxin K_oxygenase FMO-like
Motif
Other DBs
NCBI-ProteinID: AFP32659
UniProt: M1FJQ7
LinkDB All DBs
Position
complement(3888042..3889610)
Genome map
AA seq 522 aa AA seqDB search
MLDAKLKDQLKGYLDNVKQPIELVVALDDSAKASELYELLQEIDALSDMITLREDGDSDV
RRPSFAINRVGTDIGVRFAGIPMGHEFTSLVLALLQVGGHPSKATPELIQQVQELDGNFE
FETYFSLSCQNCPDVVQALNLMSVLNPSVKHTAIDGALFQAEVEEREIMAVPSVYLNGKL
FGQGRMKLEEIVAKLDTNTDAREADKIRQKGIFEVLVIGGGPAGSAAAVYAARKGITTGI
AAERFGGQVADTMGIENLISVPYTEGPKLVAAMEQNVIEYGVDIMNMQRAEKLIPATKPG
MPHEIRMANGASLKARTLVLSTGARWRQLGVPGEDKYRNKGVAYCPHCDGPLFKGKRVAV
IGGGNSGVEAAIDLAGIVGHVTLLEFGVELRADEVLQRKLRSLKNVDVAVSAQTTEVTGA
NGKVNGLDYTDRNSGKNVHVELEGVFIQIGLLPNTEWLKGDIELSKHGEVVINERNETSI
PGVFAAGDATTVPYKQIVISMGEGSKAALSAFDFLIRNSTDE
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atgttagatgccaagctgaaagaccagttgaaaggttacctggacaatgtaaaacagccc
attgagctggttgtggcgctggacgacagtgcaaaagctagcgagctgtatgagctgctg
caggaaatcgacgcgttgtctgacatgattactctgcgtgaagatggcgactctgacgtg
cgtcgcccgtcatttgctattaaccgtgttggtaccgacataggtgtgcgctttgccggt
atccctatgggccacgagtttacgtcactggtgttggcattgttgcaggtgggtggacac
ccttccaaggccactcccgagttgattcagcaggtacaggaactggacggcaattttgaa
tttgaaacttacttttcgctgtcatgccagaactgtccggacgtggtgcaggcgctgaac
ttgatgagtgtgctgaacccaagcgtgaagcacaccgccattgacggcgccttgttccag
gccgaggtggaagagcgtgaaatcatggcggtgcccagcgtgtacctgaacggcaagctg
tttggccagggccgtatgaagctggaagaaattgtagccaagctggacaccaacaccgac
gcccgtgaagctgataaaatccgccagaagggcatctttgaagtgttggtaatcggcggt
ggccccgctggctccgcagcggctgtttacgcggcccgtaaaggcatcaccaccggcatt
gccgctgaacgttttggcggtcaggttgctgacaccatgggcattgaaaatctgatttcc
gtgccctacacagaaggccccaagttagtggccgcgatggagcagaacgtcatagagtat
ggtgtggatatcatgaacatgcagcgggccgaaaagctgattccggcgacaaagccgggc
atgcctcatgaaattcgtatggccaatggtgcttcgttgaaagcccgcaccttggtgttg
tcgaccggtgcccgttggcgccagctgggtgttcccggtgaggacaagtatcgcaacaag
ggcgtggcttactgcccgcactgcgacggcccattgttcaaaggcaagcgcgtagccgtc
attggcggcggtaactcaggcgtggaagccgccatcgacctggccggtattgttggccac
gtaaccttgctggaatttggtgtcgaattgcgcgctgacgaagtgctgcagcgtaagctg
cgcagcctgaagaacgtggatgtcgcggtatcggcccagaccactgaagtgaccggtgca
aacggtaaggtgaatggcctggactacacggatcgcaacagcggtaaaaatgttcacgta
gagctggaaggcgtgttcatacaaatcggcctgttacccaacaccgagtggctgaaaggc
gatatcgaactcagcaagcacggagaggtagtcatcaacgagcgcaatgaaaccagcatt
cctggcgtatttgccgccggtgatgctaccaccgtgccctacaagcagatcgtgatttcc
atgggtgaaggttccaaagcggccctaagtgcctttgacttcctgattcgcaactctact
gacgaatag

DBGET integrated database retrieval system