KEGG   Marinobacter sp. BSs20148: MRBBS_3760
Entry
MRBBS_3760        CDS       T02323                                 

Gene name
gtfA
Definition
(GenBank) Sucrose phosphorylase
  KO
K23079  glucosylglycerol phosphorylase (configuration-retaining) [EC:2.4.1.359]
Organism
mbs  Marinobacter sp. BSs20148
Brite
KEGG Orthology (KO) [BR:mbs00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    MRBBS_3760 (gtfA)
Enzymes [BR:mbs01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.359  glucosylglycerol phosphorylase (configuration-retaining)
     MRBBS_3760 (gtfA)
SSDB
Motif
Pfam: Alpha-amylase
Other DBs
NCBI-ProteinID: AFP32696
UniProt: M1FB80
LinkDB
Position
3923415..3924857
AA seq 480 aa
MLLKNAVQLICYPNRIGNNLKDLYTVVDKHLSEAIGGLHILPFFPSNADGGFSPLTHKEV
DPDFGTWDDIEAFTKKYDLCVDLTVNHISDESPEFRDFIAHGFDSEYADLFVHVDKFGEI
SPDDMAKIHIRKEKEPFREVTLADGTKTRVWCTFTDQQIDLNYESDQAYRLMESYIGFLT
SKGVNLLRLDAFGYTTKRIGTSCFLVEPEVYRILDWINEVALKHGAECLPEVHDHTSYQY
AIGRRNMHPYGFALPPLLLYSLLDANSVYLKNWLRMCPRNMVTVLDTHDGICIPDVEGVL
PDEKIRALIDNIDARSADPIMRRSAANIHSVGAIYQLTCTFYDALMQNDDAYIAARAIQF
FTPGIPQVYYVGLLAGCNNHELMKQSGELRDINRHYYTLDDVEQHIQKPVVQRLLALMTF
RSNYPAFDGHFELNYSNNSSVAMAWRHGDYYCHLFVDLNFNTVKIGYYDLDTAQMEKLAC
NT seq 1443 nt   +upstreamnt  +downstreamnt
atgctgttaaaaaatgccgtgcagctgatttgctacccaaaccgaattggcaataacctg
aaagacctctacacagtggtcgacaaacacctgtcagaggccattggagggctgcatatc
ttgccgttttttccgtccaatgccgatggcgggttttcgcccttgactcacaaggaagtg
gatccggattttggtacctgggacgacattgaagccttcacgaaaaagtacgacctgtgt
gtcgacctgacggtgaaccatatctctgacgagtctcccgagtttagggatttcatcgcc
catggcttcgattcggagtatgccgacctgttcgttcatgtcgacaagttcggcgagatt
tctccggatgacatggccaagattcatatccgcaaagagaaagaacccttccgggaagtg
acgcttgcggatggcacaaaaacccgggtctggtgcacattcaccgaccagcagattgat
ctcaattacgagtccgaccaggcttaccgcctgatggaaagctatatcggctttctcact
tcaaaaggcgtaaacctgttgaggctcgatgcctttggttacaccaccaaacgtatcgga
accagctgctttttggtggagcccgaggtctatcggatactcgactggattaacgaagtg
gccctgaaacacggtgcggaatgcctgccggaagtccacgatcacaccagttatcaatac
gcgatcggccgacgcaacatgcacccctacggctttgctctgccgccccttttgctctac
tcgctgctggacgcaaacagcgtatacctgaaaaactggctgcgaatgtgcccacgcaac
atggtgaccgtattagatacccacgacggcatctgtattccggatgtcgaaggggtgttg
ccagatgaaaaaattcgcgcgcttattgataacattgatgcccgcagtgcagacccgatc
atgcggcgctcagcggccaacatccacagcgttggtgcaatctaccagctcacctgcacc
ttctacgacgcgctcatgcagaacgatgacgcctacattgccgcccgggcgattcagttt
ttcacacccggcattccgcaggtctactacgtggggttgttggctggatgcaacaaccac
gaactgatgaaacaaagcggcgaactgcgggatatcaatcgccattactacaccctggat
gacgtggaacaacacattcagaagcccgtcgtgcaacgcttactggccctgatgacgttt
cgtagtaactaccctgcttttgatggccattttgaactcaactactctaacaattccagc
gtggccatggcctggcgccatggagactattactgccatctgtttgtcgacctgaacttt
aataccgtaaaaatcgggtattacgacctcgacaccgcacaaatggaaaaacttgcgtgt
taa

DBGET integrated database retrieval system