KEGG   Mycobacterium tuberculosis variant bovis BCG Tokyo 172: JTY_3384Help
Entry
JTY_3384          CDS       T00864                                 

Gene name
sdhA
Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
mbt  Mycobacterium tuberculosis variant bovis BCG Tokyo 172
Pathway
mbt00020  Citrate cycle (TCA cycle)
mbt00190  Oxidative phosphorylation
mbt00650  Butanoate metabolism
mbt01100  Metabolic pathways
mbt01110  Biosynthesis of secondary metabolites
mbt01120  Microbial metabolism in diverse environments
mbt01130  Biosynthesis of antibiotics
mbt01200  Carbon metabolism
Module
mbt_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mbt_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
mbt_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:mbt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    JTY_3384 (sdhA)
   00650 Butanoate metabolism
    JTY_3384 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    JTY_3384 (sdhA)
Enzymes [BR:mbt01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     JTY_3384 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     JTY_3384 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C
Motif
Other DBs
NCBI-ProteinID: BAH27660
LinkDB All DBs
Position
3691618..3693240
Genome map
AA seq 540 aa AA seqDB search
MCAALANVEDDNWEWHTFDTVKGGDYLADQDAVEIMCKEAIDAVLDLEKMGMPFNRTPEG
RIDQRRFGGHTRDHGKAPVRRACYAADRTGHMILQTLYQNCVKHDVEFFNEFYALDLALT
QTPSGPVATGVIAYELATGDIHVFHAKAVVIATGGSGRMYKTTSNAHTLTGDGIGIVFRK
GLPLEDMEFHQFHPTGLAGLGILISEAVRGEGGRLLNGEGERFMERYAPTIVDLAPRDIV
ARSMVLEVLEGRGAGPLKDYVYIDVRHLGEEVLEAKLPDITEFARTYLGVDPVTELVPVY
PTCHYLMGGIPTTVTGQVLRDNTSVVPGLYAAGECACVSVHGANRLGTNSLLDINVFGRR
AGIAAASYAQGHDFVDMPPNPEAMVVGWVSDILSEHGNERVADIRGALQQSMDNNAAVFR
TEETLKQALTDIHALKERYSRITVHDKGKRFNTDLLEAIELGFLLELAEVTVVGALNRKE
SRGGHAREDYPNRDDVNYMRHTMAYKEIGADKEGPELRSDVRLDFKPVVQTRYEPKERKY
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
atgtgcgccgcgctggccaacgtcgaggacgacaactgggagtggcacacgttcgacacc
gtcaagggcggcgactatctcgccgaccaggacgccgtggagatcatgtgcaaggaagcc
atcgacgcggtgctcgacctggagaagatggggatgccgttcaaccgcacccccgagggc
cgcatcgaccagcgccgcttcggcgggcacacccgcgaccacggcaaggccccggtgcgc
cgggcctgctacgcggccgatcgcaccggccacatgattctgcagacgctgtatcagaac
tgcgtcaagcacgacgtcgagttcttcaacgaattttacgcgctggatttggctttgact
caaacgccgtcgggcccggtggccaccggggtgatcgcctacgagctagcgaccggtgac
atccatgtctttcacgccaaggccgtcgtgatcgcgaccggcggctcgggccgcatgtat
aagaccacgtccaacgcacacaccctgaccggcgacggcatcggcatcgtgttccgcaag
ggacttcccttggaggacatggagtttcaccagtttcaccctaccggcctggccggtctg
ggcatcttaatctccgaagcggtgcgcggcgaaggcggccggctgctcaacggggaaggt
gagcgtttcatggagcgctacgccccgacgatcgtcgacctagcgccccgcgacatcgtc
gcccgctcgatggtgctggaagtgctggagggacgcggcgccggaccgctcaaggactac
gtctacatcgacgtccgccacctgggcgaggaagtgctcgaggccaagctgcccgacatc
accgagttcgcccgcacctacctgggcgtggatccggtcaccgagctggtgccggtctac
ccgacgtgccactacctgatgggcggcatcccgaccacagtcaccgggcaggtgctgcgg
gacaacaccagcgttgtcccgggcctgtatgcggccggcgagtgcgcctgcgtgtcggtg
catggcgccaaccggctgggcaccaactcgctgttggatatcaacgtcttcggtcgtcgg
gccggcatcgccgccgccagttatgcgcagggtcacgactttgtcgacatgccgcccaac
ccggaggccatggtggtgggctgggtcagcgacatcctgtccgaacacggaaacgagcgg
gtcgccgacattcgcggggcgctgcagcagtcgatggacaacaacgccgcggtgttccgc
accgaggagaccctgaagcaggcgctcaccgacatccacgcgctcaaggagcgctactcc
cgaatcacggtgcacgacaaggggaaacgcttcaacaccgacctgctggaagccatcgag
ctgggatttttactggagctggccgaggtcacggtggtcggcgctttgaatcgcaaggag
tcccgcggcggtcacgcccgcgaggactatcccaaccgcgacgacgtcaactacatgcga
cacaccatggcctacaaggaaattggggccgataaggagggccccgagctgcgcagcgat
gtccgccttgatttcaaacccgtcgtgcagacccgttacgaacccaaggaacggaagtac
taa

DBGET integrated database retrieval system