KEGG   Mycobacterium tuberculosis variant bovis BCG Tokyo 172: JTY_3385Help
Entry
JTY_3385          CDS       T00864                                 

Gene name
sdhB
Definition
(GenBank) succinate dehydrogenase iron-sulphur protein subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
mbt  Mycobacterium tuberculosis variant bovis BCG Tokyo 172
Pathway
mbt00020  Citrate cycle (TCA cycle)
mbt00190  Oxidative phosphorylation
mbt00650  Butanoate metabolism
mbt01100  Metabolic pathways
mbt01110  Biosynthesis of secondary metabolites
mbt01120  Microbial metabolism in diverse environments
mbt01130  Biosynthesis of antibiotics
mbt01200  Carbon metabolism
Module
mbt_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mbt_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
mbt_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:mbt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    JTY_3385 (sdhB)
   00650 Butanoate metabolism
    JTY_3385 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    JTY_3385 (sdhB)
Enzymes [BR:mbt01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     JTY_3385 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     JTY_3385 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_10 Fer4_17 Fer4_9 Fer4_18 Fer4_7 Fer4_15 Fer4 Fer4_4
Motif
Other DBs
NCBI-ProteinID: BAH27661
LinkDB All DBs
Position
3693240..3694031
Genome map
AA seq 263 aa AA seqDB search
MSVEPDVETLDPPLPPVPDGAVMVTVKIARFNPDEPDAFAATGGWQSFRVPCLPSDRLLN
LLIYIKGYLDGTLTFRRSCAHGVCGSDTMRINGVNRLACKVLMRDLLPKKKGKSLTVTVE
PIRGLPVEKDLVVDMEPFFDAYRAIKPYLITSGNPPTRERIQSPTDRARYDDTTKCILCA
CCTTSCPVFWHEGSYFGPAAIVNAHRFIFDSRDEAAAERLDILNEVDGVWRCRTTFNCTE
SCPRGIEVTKAIQEVKRALMFTR
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtcgagccggacgtcgaaactttggatccgcccctaccgccggtaccggacggc
gcggtgatggtgaccgtcaagatcgcccggttcaaccccgacgagcccgacgcgttcgcg
gccaccggcggctggcagagcttccgggtgccctgtttgcccagcgatcggctgctcaac
ctgctcatctacatcaagggctacctcgacggcacgctcaccttccggcgatcctgcgcc
catggggtgtgcggctctgataccatgcgcatcaacggggtgaaccggctggcctgcaag
gtgctgatgcgtgacctgctgccgaagaagaagggcaaatcgttgaccgtcacggtcgag
ccgatccgcgggctgccggtggaaaaggacctggtggtcgacatggagccgttcttcgac
gcctaccgggcgatcaaaccgtacctgatcaccagcggcaacccgcccacccgcgaacgg
atccagagcccgaccgaccgcgcccgctacgacgacaccaccaagtgcatcctgtgcgcg
tgctgcaccaccagctgcccggtgttctggcacgagggcagctacttcggcccggcggcg
atcgtcaacgcgcaccgcttcatcttcgacagccgcgacgaggccgccgccgagcgcctc
gacatcctcaacgaggtcgacggggtgtggcgctgccgcaccacgttcaactgcaccgaa
tcctgcccacggggcattgaggtgaccaaggcgatccaggaggtcaagcgcgcgctgatg
ttcacccgctga

DBGET integrated database retrieval system