KEGG   Mycobacterium tuberculosis variant bovis BCG Tokyo 172: JTY_3389Help
Entry
JTY_3389          CDS       T00864                                 

Gene name
moaX
Definition
(GenBank) putative MoaD-MoaE fusion protein
  KO
K21142  MoaE-MoaD fusion protein [EC:2.8.1.12]
Organism
mbt  Mycobacterium tuberculosis variant bovis BCG Tokyo 172
Pathway
mbt00790  Folate biosynthesis
mbt01100  Metabolic pathways
mbt04122  Sulfur relay system
Brite
KEGG Orthology (KO) [BR:mbt00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    JTY_3389 (moaX)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04122 Sulfur relay system
    JTY_3389 (moaX)
Enzymes [BR:mbt01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.1  Sulfurtransferases
    2.8.1.12  molybdopterin synthase
     JTY_3389 (moaX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MoaE ThiS Attacin_N
Motif
Other DBs
NCBI-ProteinID: BAH27665
LinkDB All DBs
Position
complement(3695517..3696182)
Genome map
AA seq 221 aa AA seqDB search
MITVNVLYFGAVREACKVAHEKISLESGTTVDGLVDQLQIDYPPLADFRKRVRMAVNESI
APASTILDDGDTVAFIPQVAGGSDVYCRLTDEPLSVDEVLNAISGPSQGGAVIFVGTVRN
NNNGHEVTKLYYEAYPAMVHRTLMDIIEECERQADGVRVAVAHRTGELRIGDAAVVIGAS
APHRAAAFDAARMCIERLKQDVPIWKKEFALDGVEWVANRP
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgattactgtcaatgtgctctactttggcgcggttcgcgaagcgtgcaaggtcgctcac
gagaagatctcactcgaaagcggcaccaccgtcgacggcttagtcgaccaattgcaaatc
gactatccgccacttgctgattttcgcaagcgagtgcggatggccgttaacgaatccata
gcgccagcatcaacgattctcgacgatggcgacacggtggcgttcataccgcaggttgcc
gggggctccgatgtctactgccggctcaccgatgagccgctgagcgtcgatgaagtgctc
aacgcgatatctggaccttcccagggcggcgccgtcatcttcgtgggtaccgtgcgtaac
aacaacaacggccacgaagtgaccaagttgtactacgaggcctatccggccatggtgcac
cgcacgctgatggacatcatcgaagagtgtgaacgacaggccgacggtgtgcgagttgcc
gtggcacaccggaccggtgaattgcgcatcggtgatgcggcggttgtcatcggtgcttcg
gctcctcaccgcgcggccgcgttcgacgccgctcgcatgtgcatcgagcggctcaaacag
gatgtgccgatatggaagaaggagttcgcactcgacggtgttgagtgggtggccaatcgg
ccatga

DBGET integrated database retrieval system