KEGG   Mycobacterium tuberculosis variant bovis BCG Tokyo 172: JTY_3911Help
Entry
JTY_3911          CDS       T00864                                 

Gene name
sodA
Definition
(GenBank) Fe-superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
mbt  Mycobacterium tuberculosis variant bovis BCG Tokyo 172
Brite
Enzymes [BR:mbt01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     JTY_3911 (sodA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: BAH28181
LinkDB All DBs
Structure
PDB: 

Position
4290296..4290919
Genome map
AA seq 207 aa AA seqDB search
MAEYTLPDLDWDYGALEPHISGQINELHHSKHHATYVKGANDAVAKLEEARAKEDHSAIL
LNEKNLAFNLAGHVNHTIWWKNLSPNGGDKPTGELAAAIADAFGSFDKFRAQFHAAATTV
QGSGWAALGWDTLGNKLLIFQVYDHQTNFPLGIVPLLLLDMWEHAFYLQYKNVKVDFAKA
FWNVVNWADVQSRYAAATSQTKGLTFG
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
gtggccgaatacaccttgccagacctggactgggactacggagcactggaaccgcacatc
tcgggtcagatcaacgagcttcaccacagcaagcaccacgccacctacgtaaagggcgcc
aatgacgccgtcgccaaactcgaagaggcgcgcgccaaggaagatcactcagcgatcttg
ctgaacgaaaagaatctagctttcaacctcgccggccacgtcaatcacaccatctggtgg
aagaacctgtcgcctaacggtggtgacaagcccaccggcgaactcgccgcagccatcgcc
gacgcgttcggttcgttcgacaagttccgtgcgcagttccacgcggccgctaccaccgtg
caggggtcgggctgggcggcactgggctgggacacactcggcaacaagctgctgatattc
caggtttacgaccaccagacgaacttcccgctaggcattgttccgctgctgctgctcgac
atgtgggaacacgccttctacctgcagtacaagaacgtcaaagtcgactttgccaaggcg
ttttggaacgtcgtgaactgggccgatgtgcagtcacggtatgcggccgcgacctcgcag
accaaggggttgacattcggctga

DBGET integrated database retrieval system