KEGG   Methanococcoides burtonii: Mbur_1088Help
Entry
Mbur_1088         CDS       T00341                                 

Gene name
dnl1
Definition
(GenBank) DNA ligase 1, ATP-dependent
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
mbu  Methanococcoides burtonii
Pathway
mbu03030  DNA replication
mbu03410  Base excision repair
mbu03420  Nucleotide excision repair
mbu03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:mbu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    Mbur_1088 (dnl1)
   03410 Base excision repair
    Mbur_1088 (dnl1)
   03420 Nucleotide excision repair
    Mbur_1088 (dnl1)
   03430 Mismatch repair
    Mbur_1088 (dnl1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mbu03032]
    Mbur_1088 (dnl1)
   03400 DNA repair and recombination proteins [BR:mbu03400]
    Mbur_1088 (dnl1)
Enzymes [BR:mbu01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     Mbur_1088 (dnl1)
    6.5.1.6  DNA ligase (ATP or NAD+)
     Mbur_1088 (dnl1)
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     Mbur_1088 (dnl1)
DNA replication proteins [BR:mbu03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    Mbur_1088 (dnl1)
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     Mbur_1088 (dnl1)
DNA repair and recombination proteins [BR:mbu03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     Mbur_1088 (dnl1)
   NER (nucleotide excision repair)
    Other NER factors
     Mbur_1088 (dnl1)
   MMR (mismatch exicision repair)
    Other MMR factors
     Mbur_1088 (dnl1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C
Motif
Other DBs
NCBI-ProteinID: ABE52018
UniProt: Q12X08
LinkDB All DBs
Position
1166020..1167723
Genome map
AA seq 567 aa AA seqDB search
MTDFKEFADVCKQIEHISSSLEMTDVVSDMLKSISTEELPVVTHFVMGDVFPAWSVEQLG
VGTSLLYSALSESSGLSLKEIEDLVRSTGDIGETAVAALGKKKKNKKKNQASLSFFSEDA
ASVSISIMDVFERFLDISRYSGAGSQSSKMRNLQFLFNSSSSEEARYLARLTIEDLRIGV
GEGIVRDAISKAFDVPAGDIERGFMLTNDLGLVAVAAKEGGIEEISKLRMELDRPIKMML
AQVTPSIEAAIKDLGMLAVEWKFDGARVQIHKKGDSINIFSRRLENVTLSLPDIVEAVKL
HVKADSAILEGEAVAVDENGAPRAFQDILKRFRRKYDVETMVREIPLTLNLFDILYLNGD
VLMDQSLLRRREQLVACVENCDSIKVDEQVLTDDVNVVNDIYAAALNGGHEGVMLKNPEA
SYSPGKRGKNWLKKKPIMETLDLVVIAAEWGYGKRANLIGSYALACFDPEDGKFLPIGKV
ATGFSDEQLAELTEVFSELIIGESGREIELKPDVVFEIAFEEIQKSTNYGSGYALRFPRL
VNVREDKSPEEAETIDRIESIYLSQRG
NT seq 1704 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacttcaaggaattcgctgatgtttgtaaacagatagaacatatctcaagttca
ctggaaatgacagatgttgtctcggatatgttaaagtcgatatcgacagaggaacttcct
gttgtgacccattttgtgatgggggacgtttttcctgcatggagtgttgaacagcttggg
gtgggtacgagtcttttgtatagtgccctttcggaatcatccggtctttccctgaaagag
attgaggaccttgtccgttccaccggtgatataggggagacagcggtagcagcacttggt
aagaagaaaaagaataagaaaaagaatcaagcatcgctctcatttttttcggaggatgca
gcttctgtctctatctccataatggatgtctttgaaaggttccttgatatttccagatat
tcaggtgcaggttcgcagagttctaagatgaggaaccttcaattccttttcaattcttcc
agctccgaagaagcacggtatcttgcccgactgactatcgaagaccttcgtattggtgtc
ggtgaaggtatcgttcgtgatgctatttcaaaagctttcgatgttccggcaggggatatt
gaacgtggttttatgttaacgaacgatctgggtcttgtggcagttgctgcaaaagagggt
ggtattgaggagatatcaaagctcaggatggagcttgatcgtccgataaagatgatgctg
gcacaggttacgcctagtattgaagctgcgatcaaggatcttggtatgctggctgtcgag
tggaaattcgatggggcaagggttcaaattcataagaaaggggattcgatcaacatcttt
tcgagaaggcttgagaatgtgacattatctctgccggatatcgttgaggcagtgaagctt
catgtgaaggcggattccgcaattctggaaggtgaggctgtagcggtcgatgaaaatggg
gctcctcgtgctttccaggatatactcaaacgcttcaggagaaagtatgatgttgaaaca
atggttcgtgagatacctttgacattgaaccttttcgatattctgtatctgaatggggat
gtactgatggaccagtctcttttaagaagaagggaacaactggtcgcatgtgtggagaac
tgtgatagcatcaaggtggatgagcaggttctcacagatgatgtgaatgttgtgaacgat
atatatgctgctgcgcttaacggtgggcacgaaggggtcatgctaaagaacccggaagct
tcgtattctcccggcaagcggggtaagaactggctcaagaagaagcctatcatggagacg
ctcgacctcgttgtcattgctgcggaatggggttatggaaaacgtgcaaatcttatcggc
tcttatgctctggcatgttttgacccggaagatggaaaattccttccgatcggcaaagta
gctacaggtttttcagatgagcagcttgctgaacttactgaggtcttttccgagcttatt
attggtgaatccggtcgggagatcgaacttaaacctgatgtggtgttcgagatcgcattc
gaggagatccagaaaagtacgaactatggttcaggatatgctctccgtttccctcgactt
gtaaatgtgagggaagataaatctccggaagaggctgaaacgatagatcgtatcgagagc
atctatttatcacagaggggctaa

DBGET integrated database retrieval system