KEGG   Methanococcoides burtonii: Mbur_2083
Entry
Mbur_2083         CDS       T00341                                 

Gene name
pylD
Definition
(GenBank) protein with NAD binding domain, pyrrolysine biosynthesis
  KO
K16182  3-methylornithyl-N6-L-lysine dehydrogenase [EC:1.4.1.-]
Organism
mbu  Methanococcoides burtonii
Pathway
mbu00300  Lysine biosynthesis
mbu01100  Metabolic pathways
mbu01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mbu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    Mbur_2083 (pylD)
Enzymes [BR:mbu01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.-  
     Mbur_2083 (pylD)
SSDB
Motif
Pfam: NAD_binding_7 3HCDH_N NAD_binding_2 2-Hacid_dh_C F420_oxidored adh_short TrkA_N AlaDh_PNT_C Pyr_redox_2 IlvN Shikimate_DH Sacchrp_dh_NADP
Other DBs
NCBI-ProteinID: ABE52957
UniProt: Q12UB9
LinkDB
Position
complement(2186375..2187154)
AA seq 259 aa
MALLTPEDLEDLLNKLRQSNETIKASTGKGITEICEEVYGTRPASQKVAIVPITAGNGII
GNFSSSLLAITEYFGLEGYITDHPDITGYHQAVSDGADILLMADDHMFIAHNLKNGKIAA
NHICTGVIYSEIASRFIHAGSKDVMVIGLGRVGYAGAEHLVKKGFNVYAYDPNTEFMEKA
IEELGVNAYDSADHKKFSMVFEATPNANTISEGMITDRCLISTPGIPCALPAELAENGDI
DLVMEPLVIGAAAMLYSVF
NT seq 780 nt   +upstreamnt  +downstreamnt
atggcattattaacacctgaggatctggaagatcttttgaacaaacttagacagagcaat
gaaacaatcaaggcatctaccggaaagggcatcacggaaatatgtgaagaggtctatggc
acacgaccagcctcccaaaaggttgcaatcgtgcccataaccgcaggcaatggaataatt
ggcaatttttcttcatcgctgctcgcaataaccgaatatttcggacttgaaggttatatt
acagaccatcccgacataaccggatatcatcaggcagtttccgatggggcggacatactt
ctaatggcagatgaccacatgttcatagcccacaacctgaagaatggaaagatagcggcc
aaccatatatgcacaggtgtgatctattccgagatagcatcaaggtttatacatgcagga
tcaaaggatgtgatggtaataggccttggtcgtgtaggttatgccggtgccgaacatctg
gtgaagaaagggttcaatgtgtacgcttatgacccgaacaccgaattcatggaaaaggca
attgaagagcttggagtcaacgcatacgatagtgcagaccataagaagttctccatggtc
ttcgaggcaacccctaacgctaatacgatatcagaaggaatgatcacagacagatgcctc
atatcgactccgggaataccctgcgcgcttccagccgaactcgctgagaacggtgatatc
gacctggtaatggaaccactggtcataggtgccgcagcaatgctctattcagtgttctga

DBGET integrated database retrieval system