KEGG   Methylomicrobium buryatense: EQU24_04500Help
Entry
EQU24_04500       CDS       T05995                                 

Gene name
aroK
Definition
(GenBank) shikimate kinase AroK
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
mbur  Methylomicrobium buryatense
Pathway
mbur00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mbur01100  Metabolic pathways
mbur01110  Biosynthesis of secondary metabolites
mbur01130  Biosynthesis of antibiotics
mbur01230  Biosynthesis of amino acids
Module
mbur_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:mbur00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    EQU24_04500 (aroK)
Enzymes [BR:mbur01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     EQU24_04500 (aroK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_18 AAA_33 Cytidylate_kin2 dNK APS_kinase AAA_17 AAA TsaE ABC_tran Cytidylate_kin Thymidylate_kin AAA_16 CoaE AAA_22 AAA_24
Motif
Other DBs
NCBI-ProteinID: QCW81589
UniProt: A0A4P9UK40
LinkDB All DBs
Position
940020..940538
Genome map
AA seq 172 aa AA seqDB search
MAKSENIYLIGLMGAGKTTIGRLLAKSLKMPFYDSDKIIEDLTGVDIPTIFEFEGEVGFR
DREQKALAGLTKLTHVVLATGGGAVIREENRECLKENGFVVYLQCSVDRILERTKRDTQR
PLLQTDNPRAKLEQLLIEREPLYLSCADYVVDSGTLQSKAAVKNILQRYRDL
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atggctaaatcggagaacatttatctcatcggtctaatgggggccggcaaaacgacaatc
ggcaggctattggccaaatcgttaaaaatgccgttttacgatagcgacaagattatcgaa
gatttgaccggcgtcgatattccaacgatcttcgaattcgaaggtgaggtaggttttcgg
gatcgggaacaaaaagcgttagctggtttgacgaaattgactcatgtcgtgttggcgacc
ggcggcggtgcagttatccgcgaagaaaatcgggaatgtctcaaggaaaacggttttgtg
gtttatttgcaatgttcggtggatagaattttggaaagaaccaagcgcgatacgcagcgg
ccgttactgcaaaccgacaatccgagagcgaagttggaacagttgttaatcgagcgcgag
cctttatatttgtcatgtgccgattatgtcgtcgatagcggcacattacagagtaaggct
gcggttaaaaatatattgcagcgttatagagatttatga

DBGET integrated database retrieval system