KEGG   Methylomicrobium buryatense: EQU24_09225
Entry
EQU24_09225       CDS       T05995                                 

Definition
(GenBank) GHKL domain-containing protein
  KO
K07637  two-component system, OmpR family, sensor histidine kinase PhoQ [EC:2.7.13.3]
Organism
mbur  Methylomicrobium buryatense
Pathway
mbur01503  Cationic antimicrobial peptide (CAMP) resistance
mbur02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mbur00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    EQU24_09225
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    EQU24_09225
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mbur01001]
    EQU24_09225
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:mbur02022]
    EQU24_09225
   01504 Antimicrobial resistance genes [BR:mbur01504]
    EQU24_09225
Enzymes [BR:mbur01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     EQU24_09225
Protein kinases [BR:mbur01001]
 Histidine kinases
  OmpR family
   EQU24_09225
Two-component system [BR:mbur02022]
 OmpR family
  PhoQ-PhoP (magnesium transport)
   EQU24_09225
Antimicrobial resistance genes [BR:mbur01504]
 Gene sets
  CAMP resistance modules
   Cationic antimicrobial peptide (CAMP) resistance, protease PgtE [MD:M00744]
    EQU24_09225
SSDB
Motif
Pfam: HATPase_c HATPase_c_5 HisKA HATPase_c_2 HAMP HATPase_c_3
Other DBs
NCBI-ProteinID: QCW82401
UniProt: A0A4P9UQ66
LinkDB
Position
2042317..2043660
AA seq 447 aa
MNSKSLSFRLLVSAGVVLASFFILVAIVLEQGYRESAEQTLRENLKIQVYSLLSAAELTR
AGQIKMPKELREPRFSNPGSGLYAWIQPVDGDVVWFSPSAIGLNASSAPEMESGKFVFLL
DEQGRYVLHYKVIWENHRGKEQEYIFSVAEESLFVAKQVDRFKTALGSWLLAMGLILILI
QFLVLRWGLSPLRLIVRDLEAIERGEKSLLDGSYATELRGLARNLNALISSERAHLERYR
NTLADLAHSLKTPLAILRGSIDSPVLNKKTVHDQISRMDEIVEYQLQRAAAKGEKKITGT
MDASLGVDKIIASMKKVHADKPIVFEIKKPDKFKIYCEQGDFYEIAGNLIDNACKWCDKK
VKVSILNKNQIKQEGFSFLLQIEDDGPGIPVDHLNDILKRGVRADQNTDGHGIGMAVVNE
IIDLLGGQLLGDKSQSLGGMRWQVYLP
NT seq 1344 nt   +upstreamnt  +downstreamnt
ttgaattctaaatcgctcagttttcgtttattggtttccgccggcgtcgttttggcctcg
ttttttatattggttgccattgtcttggagcaaggttatcgagaaagcgccgagcaaacg
ctccgggaaaacttaaaaattcaagtttactcgctgttgtcggcagctgagctgactcga
gccgggcaaatcaagatgcccaaagagttacgagagccgcgcttttctaatccgggttcc
ggcctttatgcttggatacagccggtcgatggggatgtcgtgtggttttccccttcggca
atcggtttgaatgcctcttcagcaccggagatggagtccggtaaatttgtatttttgctc
gacgaacaaggtcgttatgttttgcattacaaagtgatttgggaaaatcaccgaggcaag
gagcaagaatatattttcagcgtagccgaggaaagtttgtttgtcgctaagcaagtcgat
cgatttaaaactgcattaggttcttggttgttggcgatgggcttgattttaattctgatt
caatttttagttctgcgctggggtttgagtccgcttcgtttgatcgtgagagatctggaa
gcaatcgagcgaggagaaaagtctttacttgatggtagttatgcgacggaattgcgagga
ttggctagaaaccttaatgcattgatcagtagcgagcgggcgcatcttgagcgttatcgt
aatactttggcggatttggcgcatagtttaaaaacgccgctagcaattctaagggggagt
attgattcgcctgtgttgaataaaaagaccgtgcatgatcagatttctcggatggacgaa
atcgttgaatatcaacttcaacgggccgcggctaagggcgaaaaaaagataaccggcacg
atggatgcctctctgggagttgataaaattattgcgtcaatgaaaaaagtacatgcggat
aaaccgattgtgttcgagatcaaaaagcccgataaattcaagatttattgcgaacaaggg
gatttttacgaaatcgccggtaatttgatcgacaatgcttgtaaatggtgtgataaaaaa
gtcaaggtcagtattctgaataaaaatcaaatcaagcaggaaggattttcgtttttattg
caaatcgaagacgacggtccggggattcctgtcgaccatctgaacgatattcttaaacgg
ggtgtccgggccgatcaaaataccgacgggcatgggataggcatggcggtggtcaatgaa
attatcgatttgttgggggggcaattgttgggcgataaaagtcaaagtctgggcggcatg
cgctggcaggtttatttgccgtaa

DBGET integrated database retrieval system