KEGG   Methylomicrobium buryatense: EQU24_12700Help
Entry
EQU24_12700       CDS       T05995                                 

Gene name
accC
Definition
(GenBank) acetyl-CoA carboxylase biotin carboxylase subunit
  KO
K01961  acetyl-CoA carboxylase, biotin carboxylase subunit [EC:6.4.1.2 6.3.4.14]
Organism
mbur  Methylomicrobium buryatense
Pathway
mbur00061  Fatty acid biosynthesis
mbur00620  Pyruvate metabolism
mbur00640  Propanoate metabolism
mbur01100  Metabolic pathways
mbur01110  Biosynthesis of secondary metabolites
mbur01120  Microbial metabolism in diverse environments
mbur01130  Biosynthesis of antibiotics
mbur01200  Carbon metabolism
mbur01212  Fatty acid metabolism
Module
mbur_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:mbur00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    EQU24_12700 (accC)
   00640 Propanoate metabolism
    EQU24_12700 (accC)
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    EQU24_12700 (accC)
Enzymes [BR:mbur01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     EQU24_12700 (accC)
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     EQU24_12700 (accC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 Biotin_carb_N Biotin_carb_C Dala_Dala_lig_C ATP-grasp ATP-grasp_3 GARS_A
Motif
Other DBs
NCBI-ProteinID: QCW83001
UniProt: A0A4P9URM1
LinkDB All DBs
Position
2849626..2850969
Genome map
AA seq 447 aa AA seqDB search
MFDKIVIANRGEIALRILRACRELGIKVVAVHSVADRDLKHVRLADESVCIGPAPSSESY
LNIPAIISAAEVTDAEAIHPGYGFLSENADFSEKVKQSGFVFIGPNADTIRIMGDKIAAK
KAMIAAGIPCVPGNGNPLTDNNKQNLQMAQEIGYPVIIKAAGGGGGRGMRTVHTEAALIN
AITMTKAEAAAAFGNDTVYMEKFLEDPRHIEFQVMADSHGNAIHLGERDCSMQRRHQKVV
EEAPAPGITDEERNRMGELCAKACRDIGYLGAGTFEFLYEKGEFFFIEMNTRVQVEHPVT
EMVTGFDIVKEQLRIAYGLPLSITQEQVKIQGHAIECRLNAEDPKTFMPCPGTIHQFHMP
GGPGIRCETHIYNGYKVPPYYDSMIGKLIAHGENRNSAIARMTTALNEMVIDGIKTNIPL
QKDIMTDSGFIAGQRNIHYLEKLLGLT
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgttcgataaaatagttatcgccaatcgaggcgaaatagcgttgcgcattctacgcgct
tgccgtgaattaggaatcaaggtcgttgcggtccattccgtggccgaccgggatctaaag
catgtcaggctggccgacgaatcggtttgcattggtcccgcaccgtcctccgaaagctat
ctgaatattccggccatcatcagcgctgccgaagtcaccgacgccgaagccattcatccg
ggatacggatttctgtccgaaaatgccgatttttcggaaaaagtgaagcaaagcggcttt
gtttttatcggtccgaatgcagatacgatccgcataatgggcgacaaaatcgccgcaaaa
aaggcaatgatagcagccggcattccatgtgtgccgggcaacggcaatccgttaaccgac
aataacaaacagaacctgcaaatggctcaggaaatcggctacccggttatcattaaagcc
gccggcggcggtggcggacgcggtatgcgtaccgtacataccgaagccgcattgatcaat
gccattaccatgacgaaagcggaagcggctgccgcattcggcaacgatactgtgtacatg
gaaaaattcctggaagatccccgccatatcgaattccaggtgatggccgactcgcacggc
aatgcaatacatctgggcgagcgtgattgctcgatgcagcgcaggcaccaaaaagtcgtc
gaggaagcgcccgctcccggcattaccgacgaagaacgtaatcgcatgggcgaattgtgc
gcgaaagcctgccgcgacatcggctacctgggcgccgggaccttcgaattcttgtatgaa
aaaggcgagtttttcttcatagaaatgaatacgcgggttcaagtcgagcatccggttacc
gaaatggtcaccggcttcgatatcgttaaggaacaattacgtatcgcctacggcttaccc
ttatcgattactcaagagcaagtcaaaattcagggtcatgcgatcgagtgccgactcaat
gccgaggaccctaaaaccttcatgccctgccccggcacaatccatcaattccatatgccg
ggaggccccggcatacgatgcgaaacgcacatctataacggttacaaagtaccgccctat
tacgactcgatgatcggcaagctaatcgcgcacggcgaaaaccgcaatagtgcgattgca
agaatgacgaccgcattgaacgaaatggtaatcgatggtataaaaactaatataccgctc
caaaaagacattatgaccgactccggattcatcgccggacaacgcaatattcattatctt
gaaaagctactgggcttaacctag

DBGET integrated database retrieval system