KEGG   Methanosarcina barkeri Wiesmoor: MSBRW_0096Help
Entry
MSBRW_0096        CDS       T03839                                 

Definition
(GenBank) Ribulose-1,5-bisphosphate carboxylase, Type III
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
mbw  Methanosarcina barkeri Wiesmoor
Pathway
mbw00630  Glyoxylate and dicarboxylate metabolism
mbw01100  Metabolic pathways
mbw01120  Microbial metabolism in diverse environments
mbw01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mbw00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    MSBRW_0096
Enzymes [BR:mbw01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     MSBRW_0096
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: AKB49349
UniProt: A0A0E3QI40
LinkDB All DBs
Position
100712..101998
Genome map
AA seq 428 aa AA seqDB search
MQRDYIDAGYSPKDTDLICEFHIEPSAGVNFEEAATHMAGESSIDSWTEIATLSPELAAR
LKPHVFYMDEDAQTVRVAYSEELFELGSVPQVLSAVAGNILSMKIVDNLRLQDIAFPKSM
LREFKGPGFGLSGIRELTGVQDRPLIGTIVKPKVGLTSEKHAEVAYNSFAGGCDLVKDDE
NLTDQKFNKFEKRAELTLKLAEKAESETGERKMYLCNITAPTCKEMIRRMNILKDLGASY
AMIDIVPAGWTALQTLREEADDAGLALHAHRCMHSAYTRNPRHGISMLVVAKLCRLIGLD
QLHIGTVVGKMHGEKHEVLSLRDECVLDNVPADESQHVLAQDWGGLKPMFPVASGGLAPT
MIPDLYTIFGRDVIMQFGGGIHAHPMGTKAGAAACRQALEASLEGVSLQEYAKNHRELEA
AINKWLKK
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgcaaagggattatatagacgcgggctacagcccgaaggatactgatcttatctgtgaa
tttcatatcgaaccgtcagcaggagtgaattttgaggaagctgcaacccatatggcaggg
gaaagttctatagattcctggactgaaattgctacgctgagtcccgaacttgcagccagg
ctaaagccacatgttttttacatggatgaggacgcacagaccgtaagggtagcttattcg
gaagagctctttgaacttggttcggttccgcaggtactcagtgcagttgcaggaaatatc
ttgagtatgaaaatcgttgacaatctcagactccaggatatagctttcccgaagtcaatg
cttcgagaattcaaaggtcctggattcgggttgtcaggaatcagggaacttacaggtgtg
caagacaggcctctcataggaactattgtcaagccgaaagttggattaacctccgaaaaa
catgctgaggttgcttacaattcctttgcaggaggctgcgaccttgttaaagatgatgag
aaccttacggatcagaaatttaacaaatttgaaaaaagagctgaacttaccctgaagctt
gcagaaaaggcagaatctgagaccggagagcgtaaaatgtatctctgcaacattactgcc
cctacctgtaaggaaatgatccgccgcatgaacatccttaaagacctgggtgccagctat
gcaatgatcgacatcgtacctgccggctggactgcacttcagaccctgagggaagaagca
gacgatgcaggactagctctccacgctcaccgatgcatgcattcagcctataccaggaac
ccgcgacacggaataagcatgcttgtagttgccaagctctgcagattgatcgggcttgac
cagcttcacataggtacggttgttgggaagatgcacggagaaaaacacgaggttctgtct
ctccgtgacgagtgtgtgctagacaatgtgcctgcagatgaaagccagcatgtccttgct
caggactggggagggttgaagcccatgtttccggttgcttccggaggtcttgcccctact
atgattcctgacctgtacactatctttggaagagatgttattatgcaatttggtggtggg
attcacgctcatccaatgggaacaaaagctggagccgctgcttgcagacaggcactcgaa
gcatctcttgaaggagttagcctgcaggaatatgcgaaaaaccacagagaacttgaagcc
gccatcaataagtggctgaagaaataa

DBGET integrated database retrieval system