KEGG   Methanosarcina barkeri Wiesmoor: MSBRW_0166
Entry
MSBRW_0166        CDS       T03839                                 

Definition
(GenBank) Proline reductase for pyrrolysine biosynthesis
  KO
K16182  3-methylornithyl-N6-L-lysine dehydrogenase [EC:1.4.1.-]
Organism
mbw  Methanosarcina barkeri Wiesmoor
Pathway
mbw00300  Lysine biosynthesis
mbw01100  Metabolic pathways
mbw01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mbw00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    MSBRW_0166
Enzymes [BR:mbw01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.-  
     MSBRW_0166
SSDB
Motif
Pfam: NAD_binding_2 NAD_binding_7 3HCDH_N
Other DBs
NCBI-ProteinID: AKB49419
UniProt: A0A0E3QHM5
LinkDB
Structure
PDB: 

Position
180658..181437
AA seq 259 aa
MALLTPDDLININMQLQKADSAVQEVTGLDIKGICKALYGTFSSSEKVGIVPVTSGNGII
GNFSASLHAITQYFGFDSFVTDMPDVSGYYEAVQNGAEIILMADDRTFLAHNLKNGKMAN
NQPCTGIIYAEIASRYLKADSKDVLVVGLGKVGFPGAEHLVQKDFRVYGYDADETLLERA
TSNLGIIPFDPANPKKFSIIFEATPCANTIPEAVLSENCVLSTPGIPCAISEELRDKYEV
QLIAEPLGIGTASMLYSVL
NT seq 780 nt   +upstreamnt  +downstreamnt
atggcactcttaactcccgatgatttgataaacattaatatgcaacttcagaaagctgac
tctgctgtgcaagaagtaacggggcttgatataaaaggtatttgcaaggctctctacggt
actttctcgagctccgaaaaagtaggcatcgtgcctgtaacttcgggaaacggaattata
ggaaacttttcggcttccctgcatgcaattacgcagtatttcggatttgacagttttgtt
acggatatgccggatgttagcggctattatgaagctgtgcagaacggagccgagatcatc
cttatggcagacgaccgcactttccttgcccataacctcaaaaatggaaaaatggccaat
aatcaaccctgcacaggtattatctatgctgagatcgcttccagatatctgaaagccgac
tcaaaggatgtacttgttgtggggcttgggaaagtaggtttccccggagccgagcattta
gtgcagaaagactttagggtttacgggtatgatgctgatgaaactctccttgagagagcc
acttcaaacctcgggattattcctttcgaccctgcgaatccgaaaaaattttccattata
ttcgaggcgactccatgcgcaaacacgattcctgaagccgtactttcggagaattgcgtg
ctttccactcctggaatcccctgcgcaatttctgaagagcttagagataaatacgaagta
caacttatagcggaaccccttggaataggaactgcatcaatgttgtactctgtgctataa

DBGET integrated database retrieval system