KEGG   Methanosarcina barkeri Wiesmoor: MSBRW_2361Help
Entry
MSBRW_2361        CDS       T03839                                 

Definition
(GenBank) Aldehyde dehydrogenase
  KO
K22187  alpha-ketoglutaric semialdehyde dehydrogenase [EC:1.2.1.-]
Organism
mbw  Methanosarcina barkeri Wiesmoor
Pathway
mbw00040  Pentose and glucuronate interconversions
Brite
KEGG Orthology (KO) [BR:mbw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    MSBRW_2361
Enzymes [BR:mbw01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     MSBRW_2361
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh DUF1487
Motif
Other DBs
NCBI-ProteinID: AKB51614
UniProt: A0A0E3QKZ5
LinkDB All DBs
Position
3046007..3047488
Genome map
AA seq 493 aa AA seqDB search
MVQEYKLFIGGEFKDSSTGETFEDINPATLENLATIQVAGAEDVDMAVEAAEAGFRLWNE
VPAAKRAEVLFRAARILQERKEELSVLMTKEMGKVLPETRGDVQEAIDITNYAAGEGRRM
LGETTTSELKEKFCMTILRPIGVVGLITPWNFPIAIPAWKVMPALVAGNAIVFKPASDTP
LLAFKLIEVLSEAGLPPGVINLVTGPGGTVGKAVVQHPRIKAISFTGSLDTGKWIMEECS
KTMKRVSLELGGKNPVIVMDDADLELALEGVLWGAFGTTGQRCTATSRLILHEKIKDEFI
KRLLAKAKALSIGGGLLPETDIGPVINKAQLEKIERYVKIGKEEGATLLYGGNRIDPGLP
GYFFEPTIFTDVRPDMRIAQEEIFGPVLGIFTVSDLEEAITLANSTKYGLSSAIYTGNIG
NAFRAIEKVEAGITYVNAPTIGAEVHLPFGGVKGTGNGFREAGTEAVKEFSEVKAVYIDY
SGMLQKAQIDSAE
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atggttcaggagtacaaactgtttatagggggagaatttaaggactcttcaaccggagag
acttttgaagatataaatccggctactctggaaaacctggcaacaatacaggtcgctgga
gccgaggacgtggacatggcagttgaggctgctgaagcagggttcaggctctggaacgag
gttccggctgcaaaaagagctgaggtactcttcagagcagcccggattttgcaggaaagg
aaggaagaactgtctgtccttatgacaaaagagatgggaaaggtgctgcctgagacaagg
ggagatgtacaggaagccattgatatcacaaattatgccgcaggggaaggaaggcggatg
cttggagaaacaacgacttccgaactcaaggaaaagttctgcatgaccatactcaggccg
ataggagtagttggcttaataacaccctggaactttccgattgccattcctgcatggaag
gttatgccagctcttgtagctggaaacgcaattgtatttaagcctgcaagtgacacgcct
ctgcttgccttcaagctgatagaggtgcttagtgaagcaggcttgccccccggagtgata
aatctggtaacagggcccggaggcactgtcgggaaagctgtagtccagcaccctcgcata
aaagctatctcctttacaggcagccttgataccgggaaatggatcatggaagaatgttca
aaaaccatgaaaagagtctctctggaactcggaggcaaaaacccggtaattgttatggat
gatgccgaccttgaactggcccttgagggtgtgctgtggggagcttttgggactacaggg
cagcgctgtactgctacgagcaggctgattctgcatgagaagataaaggacgaattcata
aaaaggctgcttgcaaaagcaaaggctctcagtataggtgggggacttctgcctgagacg
gacatcgggcctgtaataaacaaagcgcagcttgagaagatcgaaagatacgtgaaaata
ggaaaagaagaaggagcaactcttctttacggaggaaacagaatcgatccagggcttcca
ggctatttcttcgagcccacaatatttacggatgtcaggccggacatgcggattgcacag
gaagagattttcgggccagtcctcggaatctttacagtttcagaccttgaagaagcaatc
acacttgctaatagtaccaaatacggactttcttcggcaatttacaccggaaatatagga
aacgctttcagggcaatcgaaaaagtagaagcaggaatcacatatgttaatgctcctaca
ataggagccgaagtccatctcccttttggaggggtcaaagggacaggcaacggttttcgg
gaagccggtaccgaggccgtcaaggagttttccgaggtaaaagctgtgtatatagactac
agcggcatgctgcaaaaagcccagatagattcagcagaataa

DBGET integrated database retrieval system