KEGG   Mycobacterium tuberculosis variant bovis BCG ATCC 35743: BCGT_0186Help
Entry
BCGT_0186         CDS       T03796                                 

Definition
(GenBank) Glycine oxidase ThiO
  KO
K03153  glycine oxidase [EC:1.4.3.19]
Organism
mbx  Mycobacterium tuberculosis variant bovis BCG ATCC 35743
Pathway
mbx00730  Thiamine metabolism
mbx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mbx00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    BCGT_0186
Enzymes [BR:mbx01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.19  glycine oxidase
     BCGT_0186
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO 3HCDH_N Pyr_redox_2 2-Hacid_dh_C Pyr_redox AlaDh_PNT_C FAD_binding_2 NAD_binding_2 F420_oxidored
Motif
Other DBs
NCBI-ProteinID: AHM06107
LinkDB All DBs
Position
218330..219352
Genome map
AA seq 340 aa AA seqDB search
MASDLHTGSLAVIGGGVIGLSVARRAAQAGWPVRVHRSDERGASWVAGGMLAPHSEGWPG
EERLLRLGLQSLRLWREGSFLDGLGPQLVTAHESLVVAVDRADVADLRTVADWLSAQGHP
VIWESAARDVEPLLAQGIRHGFRAPTELAVDNRALLDALCRDCERLGVRWSSQVSSLSDV
DAHTVVIANGIDAPALWPGLPIRPVKGEVLRLRWRPGCMPLPQRVIRARVRGRQVYLVPR
SDGVVVGATQYEHGRDTAPVVSGVRDLLDDACTVLPALGEYELAECEAGLRPMTPDNLPL
VQRLDSRTLVAAGHGRSGFLLAPWTAEQIVSELVSVGAAS
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atggcgtccgacctacacaccgggtcgctggctgtcatcggcggcggtgtcatcgggctg
tcggtggcccgccgtgccgcccaagccggctggccggtgcgggtgcaccgcagcgacgag
cggggggcgtcctgggttgccggcggcatgctggccccacacagcgaaggctggcccggc
gaggaacggttgttgcggctaggcctgcagtccctgcggctttggcgtgagggcagcttt
ctcgacgggctgggcccgcaactggtcaccgcgcacgagtcgctggtggtggccgtcgac
cgggccgacgtcgccgacctgcgcactgtcgcggactggttgtccgcacaggggcacccg
gtgatctgggagtcggctgcccgtgacgtcgaacccctactggcgcaaggcatccggcac
gggtttcgggcgcccaccgaactggccgtcgacaaccgcgccctgctcgacgcgctgtgc
cgtgactgcgagcgactcggagttcgctggagctcacaggtgagcagcctgtccgacgtc
gatgcgcacacggtggtgatcgccaacggcattgacgccccggccttgtggcccggcctg
ccgatacgcccggtgaagggtgaggtgctgcggctgcgatggcgaccaggttgtatgccc
ttgccgcagagagtgattcgtgcccgtgtgcgtggacgacaggtctatctggtgccacgt
tcggacggggtggtcgtcggcgccacccaatacgagcacgggcgcgacaccgcgccggtg
gtatcgggagttcgtgacctgctagacgatgcgtgtaccgtgctgccggcgctgggtgag
tacgagctggccgagtgtgaggccggactgcgcccgatgacacccgacaacttgccgctg
gtccaacgcctggattcgcggaccctggtcgcggccggtcacggccgatccggattccta
ttggcgccgtggactgccgaacagattgtgtccgaactcgtttcggttggggccgcctca
tga

DBGET integrated database retrieval system