KEGG   Mycobacterium tuberculosis variant bovis BCG ATCC 35743: BCGT_0971Help
Entry
BCGT_0971         CDS       T03796                                 

Definition
(GenBank) Enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mbx  Mycobacterium tuberculosis variant bovis BCG ATCC 35743
Pathway
mbx00071  Fatty acid degradation
mbx00280  Valine, leucine and isoleucine degradation
mbx00281  Geraniol degradation
mbx00310  Lysine degradation
mbx00360  Phenylalanine metabolism
mbx00362  Benzoate degradation
mbx00380  Tryptophan metabolism
mbx00410  beta-Alanine metabolism
mbx00627  Aminobenzoate degradation
mbx00640  Propanoate metabolism
mbx00650  Butanoate metabolism
mbx00903  Limonene and pinene degradation
mbx00930  Caprolactam degradation
mbx01100  Metabolic pathways
mbx01110  Biosynthesis of secondary metabolites
mbx01120  Microbial metabolism in diverse environments
mbx01130  Biosynthesis of antibiotics
mbx01212  Fatty acid metabolism
Module
mbx_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mbx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    BCGT_0971
   00650 Butanoate metabolism
    BCGT_0971
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BCGT_0971
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BCGT_0971
   00310 Lysine degradation
    BCGT_0971
   00360 Phenylalanine metabolism
    BCGT_0971
   00380 Tryptophan metabolism
    BCGT_0971
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BCGT_0971
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BCGT_0971
   00281 Geraniol degradation
    BCGT_0971
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BCGT_0971
   00627 Aminobenzoate degradation
    BCGT_0971
   00930 Caprolactam degradation
    BCGT_0971
Enzymes [BR:mbx01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     BCGT_0971
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: AHM06892
LinkDB All DBs
Position
complement(988557..989363)
Genome map
AA seq 268 aa AA seqDB search
MSNYRIDTRTIVPGLAVTLADGVLSVTIDRPESLNSLTKPVLAGMADAIEGAATDPRVKV
VRLGGAGRGFSSGGAISVDDVWASGPPTDTVAEANRTVRAIVALPQPVVAVVQGPTVGCG
VSLALACDLVLASDNAFFMLAHTNVGLMPDGGASALVQAAIGRIRAMHMALLPDRVPAAE
ALSWGLVSAVYPAADFDAEVDKLISRLLAGPALAIAKTKNAINAATLTELAPTLLRELDG
QALLLRTDDFAEGATAFQQRRTPMFTGR
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaactaccggatcgacactcggacaattgtcccgggtctcgccgtcaccctggcc
gacggggtgctgtcggtgaccatcgatcgcccggagagtctcaactcgctgaccaagccg
gtgctggcagggatggccgacgcgatcgagggcgcggccaccgacccacgggtgaaggtg
gtgcgcctcgggggcgccggtcgcggcttcagctccggaggggcaatcagcgttgacgat
gtgtgggccagtggcccgcctaccgacaccgtcgcggaggccaaccgcacggtgcgtgcc
attgtggcactaccacaaccggtcgttgccgtcgtgcagggaccaaccgtcggctgtggc
gtctccctggcgctcgcttgtgacctcgtattggcctccgacaatgcgtttttcatgctc
gctcacaccaacgtggggttgatgcccgacggcggcgcgtcggcgttggttcaggccgcg
atcggccgcatccgcgccatgcatatggcgctgctgccggaccgggtgccggccgccgag
gccttgtcctggggcctggtcagcgccgtctatccggccgccgacttcgatgccgaggtg
gacaagttgatctcacggctgttggccggcccagcgctggctatcgccaagacgaagaac
gcgatcaatgcggccacgctcaccgagttggcacccactctcctgcgcgaattggatggc
caggccctcctcctgcgtactgacgacttcgccgagggcgcaacggcattccagcagcgc
cggacccccatgttcaccggccgttga

DBGET integrated database retrieval system