KEGG   Mycobacterium tuberculosis variant bovis BCG ATCC 35743: BCGT_3300Help
Entry
BCGT_3300         CDS       T03796                                 

Definition
(GenBank) Glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
mbx  Mycobacterium tuberculosis variant bovis BCG ATCC 35743
Pathway
mbx00250  Alanine, aspartate and glutamate metabolism
mbx00410  beta-Alanine metabolism
mbx00430  Taurine and hypotaurine metabolism
mbx00650  Butanoate metabolism
mbx01100  Metabolic pathways
mbx01110  Biosynthesis of secondary metabolites
mbx01120  Microbial metabolism in diverse environments
mbx02024  Quorum sensing
Module
mbx_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:mbx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    BCGT_3300
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BCGT_3300
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BCGT_3300
   00430 Taurine and hypotaurine metabolism
    BCGT_3300
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BCGT_3300
Enzymes [BR:mbx01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     BCGT_3300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-ProteinID: AHM09219
LinkDB All DBs
Position
complement(3506411..3507688)
Genome map
AA seq 425 aa AA seqDB search
MDPEAAYRFIHDELMLDGSSRLNLATFVTTWMDPEAEKLMAETFDKNMIDKDEYPATAAI
EARCVSMVADLFHAEGLRDHDPTSATGVSTIGSSEAVMLGGLALKWRWRQRVGSWKGRMP
NLVMGSNVQVVWEKFCRYFDVEPRYLPMERGRYVITPEQVLAAVDENTIGVVAILGTTYT
GELEPIAEICAALDKLAAGGGVDVPVHVDAASGGFVVPFLHPDLVWDFRLPRVVSINVSG
HKYGLTYPGVGFVVWRGPEHLPEDLVFRVNYLGGDMPTFTLNFSRPGNQVVGQYYNFLRL
GRDGYTKVMQALSHTARWLGDQLREVDHCEVISDGSAIPVVSFRLAGDRGYTEFDVSHEL
RTFGWQVPAYTMPDNATDVAVLRIVVREGLSADLARALHDDAVTALAALDKVKPGGHFDA
QHFAH
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atggatcccgaggcggcctatcgcttcatccacgacgagctgatgctcgacggtagctcg
cggctgaatctggccaccttcgtgaccacctggatggacccggaggccgaaaagctgatg
gccgagacgttcgacaagaacatgatcgataaggacgaatacccggcgaccgcggccatc
gaggcgcgctgtgtgtccatggtcgccgacctgtttcacgccgagggtctgcgcgaccac
gaccccaccagcgccaccggggtgtccaccatcggctccagcgaggcggtgatgctgggt
gggctggccctgaaatggcgttggcggcaacgggtggggtcttggaaggggcgcatgccc
aatctggtgatgggttcgaacgtccaggtggtgtgggagaagttctgccgctacttcgac
gtcgaaccccgttacctgccgatggagcggggccgctacgtcatcacccccgagcaggtg
ctcgccgccgtcgacgagaacaccatcggcgtggtggcgatcttgggcaccacctatacc
ggtgaactcgaacccatcgccgagatctgcgccgcgctggacaaactggcggctggcggg
ggtgtggacgtcccggtacacgtcgacgcggccagtgggggctttgtggtgccgtttttg
catccggacctggtatgggattttcggctgccccgcgtggtgtcgatcaacgtcagcggc
cacaagtatgggctgacctatcccggcgtcgggtttgtcgtgtggcgcgggcccgagcac
ctgccggaggatctggttttccgggtcaactacctcggcggcgacatgccgaccttcacc
ctgaacttctcccgtcccggtaaccaggtggtgggccagtactacaacttcctgcggctg
gggcgcgacggctataccaaggtgatgcaggcgctgtcgcacaccgcccggtggctgggt
gaccagctgcgcgaggtggatcattgcgaggtgatctcggatggttcggcgatcccggtg
gtcagcttccggctcgccggcgaccgcgggtacacggagttcgacgtctcccatgagctg
cggaccttcgggtggcaggtgcccgcctacaccatgccggacaacgccaccgacgtggcg
gtgctgcggatcgtggttcgggaaggactctccgccgacctggcgcgggccctgcacgac
gacgcggtcaccgcgttggctgccctggacaaggtcaagccgggtggccacttcgacgca
cagcatttcgcgcactag

DBGET integrated database retrieval system