KEGG   Mycobacterium tuberculosis variant bovis BCG ATCC 35743: BCGT_3300Help
Entry
BCGT_3300         CDS       T03796                                 

Definition
(GenBank) Glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
mbx  Mycobacterium tuberculosis variant bovis BCG ATCC 35743
Pathway
mbx00650  Butanoate metabolism
mbx01100  Metabolic pathways
mbx01110  Biosynthesis of secondary metabolites
mbx01120  Microbial metabolism in diverse environments
mbx02024  Quorum sensing
Module
mbx_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:mbx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    BCGT_3300
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BCGT_3300
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BCGT_3300
   00430 Taurine and hypotaurine metabolism
    BCGT_3300
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BCGT_3300
Enzymes [BR:mbx01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     BCGT_3300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-ProteinID: AHM09219
LinkDB All DBs
Position
complement(3506411..3507688)
Genome map
AA seq 425 aa AA seqDB search
MDPEAAYRFIHDELMLDGSSRLNLATFVTTWMDPEAEKLMAETFDKNMIDKDEYPATAAI
EARCVSMVADLFHAEGLRDHDPTSATGVSTIGSSEAVMLGGLALKWRWRQRVGSWKGRMP
NLVMGSNVQVVWEKFCRYFDVEPRYLPMERGRYVITPEQVLAAVDENTIGVVAILGTTYT
GELEPIAEICAALDKLAAGGGVDVPVHVDAASGGFVVPFLHPDLVWDFRLPRVVSINVSG
HKYGLTYPGVGFVVWRGPEHLPEDLVFRVNYLGGDMPTFTLNFSRPGNQVVGQYYNFLRL
GRDGYTKVMQALSHTARWLGDQLREVDHCEVISDGSAIPVVSFRLAGDRGYTEFDVSHEL
RTFGWQVPAYTMPDNATDVAVLRIVVREGLSADLARALHDDAVTALAALDKVKPGGHFDA
QHFAH
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atggatcccgaggcggcctatcgcttcatccacgacgagctgatgctcgacggtagctcg
cggctgaatctggccaccttcgtgaccacctggatggacccggaggccgaaaagctgatg
gccgagacgttcgacaagaacatgatcgataaggacgaatacccggcgaccgcggccatc
gaggcgcgctgtgtgtccatggtcgccgacctgtttcacgccgagggtctgcgcgaccac
gaccccaccagcgccaccggggtgtccaccatcggctccagcgaggcggtgatgctgggt
gggctggccctgaaatggcgttggcggcaacgggtggggtcttggaaggggcgcatgccc
aatctggtgatgggttcgaacgtccaggtggtgtgggagaagttctgccgctacttcgac
gtcgaaccccgttacctgccgatggagcggggccgctacgtcatcacccccgagcaggtg
ctcgccgccgtcgacgagaacaccatcggcgtggtggcgatcttgggcaccacctatacc
ggtgaactcgaacccatcgccgagatctgcgccgcgctggacaaactggcggctggcggg
ggtgtggacgtcccggtacacgtcgacgcggccagtgggggctttgtggtgccgtttttg
catccggacctggtatgggattttcggctgccccgcgtggtgtcgatcaacgtcagcggc
cacaagtatgggctgacctatcccggcgtcgggtttgtcgtgtggcgcgggcccgagcac
ctgccggaggatctggttttccgggtcaactacctcggcggcgacatgccgaccttcacc
ctgaacttctcccgtcccggtaaccaggtggtgggccagtactacaacttcctgcggctg
gggcgcgacggctataccaaggtgatgcaggcgctgtcgcacaccgcccggtggctgggt
gaccagctgcgcgaggtggatcattgcgaggtgatctcggatggttcggcgatcccggtg
gtcagcttccggctcgccggcgaccgcgggtacacggagttcgacgtctcccatgagctg
cggaccttcgggtggcaggtgcccgcctacaccatgccggacaacgccaccgacgtggcg
gtgctgcggatcgtggttcgggaaggactctccgccgacctggcgcgggccctgcacgac
gacgcggtcaccgcgttggctgccctggacaaggtcaagccgggtggccacttcgacgca
cagcatttcgcgcactag

DBGET integrated database retrieval system