KEGG   Mycobacterium bovis BCG ATCC 35743: BCGT_3594Help
Entry
BCGT_3594         CDS       T03796                                 

Definition
(GenBank) ATP-dependent DNA ligase
Organism
mbx  Mycobacterium bovis BCG ATCC 35743
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C RNA_ligase
Motif
Other DBs
NCBI-ProteinID: AHM09513
LinkDB All DBs
Position
3829915..3830991
Genome map
AA seq 358 aa AA seqDB search
MQLPVMPPVSPMLAKSVTAIPPDASYEPKWDGFRSICFRDGDQVELGSRNERPMTRYFPE
LVAAIRAELPHRCVIDGEIIIATDHGLDFEALQQRIHPAESRVRMLADRTPASFIAFDLL
ALGDDDYTGRPFSERRAALVDAVTGSGADADLSIHVTPATTDMATAQRWFSEFEGAGLDG
VIAKPPHITYQPDKRVMFKIKHLRTADCVVAGYRVHKSGSDAIGSLLLGLYQEDGQLASV
GVIGAFPMAERRRLLTELQPLVTSFDDHPWNWAAHVAGQRTPRKNEFSRWNVGKDLSFVP
LRPERVVEVRYDHMEGARFRHTAQFNRWRPDRDPRSCSYAQLERPLTVSLSDIVPGLR
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgcagttacccgtcatgccgccggtgtcgccgatgctggccaaatcggtcaccgcaatc
ccgccggacgcgtcgtatgaacccaaatgggacggattccgctccatctgctttcgcgac
ggtgatcaggtcgaactgggtagccgcaacgagcggccgatgacccgctacttccccgag
ctggtcgccgcgatcagggccgagctgccgcatcgctgtgtgatcgacggggagatcatc
atcgccaccgaccacggcttggacttcgaggcgctgcaacagcgcatccatcctgccgag
tcgagggtgcgaatgcttgccgaccgcacaccagcctccttcatcgcattcgacctgctg
gccctcggcgacgacgactacaccgggcgaccgttcagcgaaagacgagccgctctggtc
gatgccgtaactggttcgggggccgacgctgacctgtcgatccacgtcaccccggcaacc
accgacatggcgaccgcacaacgatggttctccgagttcgagggggccggtctagacggt
gtcatcgccaaaccgccgcacatcacctatcaaccggacaaacgcgttatgttcaagatc
aaacacctgcggaccgccgattgcgtggtggccggctaccgggtgcacaagtccggcagt
gacgcgatcggctcactgctgctagggctttaccaggaggacggccaactcgcgtcggtc
ggcgtgatcggcgcgttccccatggccgaacgacgccggctattaaccgagctgcagccg
ctggtcaccagcttcgacgaccacccatggaactgggccgcccacgttgccggccagcgc
accccacgtaagaacgagttctcccgctggaatgtcggcaaagacctgtcgttcgtgccg
ctgcgacccgagcgggtggtcgaggtccgctacgaccacatggaaggcgcgcggttccgc
cacaccgcacagttcaaccggtggcgccccgaccgcgacccacgctcatgcagctatgcc
cagctcgaacgcccgctcaccgtcagcctctccgacattgtgccgggcctacgctaa

DBGET integrated database retrieval system