KEGG   Methanosarcina barkeri MS: MSBRM_0158
Entry
MSBRM_0158        CDS       T03838                                 

Definition
(GenBank) Proline reductase for pyrrolysine biosynthesis
  KO
K16182  3-methylornithyl-N6-L-lysine dehydrogenase [EC:1.4.1.-]
Organism
mby  Methanosarcina barkeri MS
Pathway
mby00300  Lysine biosynthesis
mby01100  Metabolic pathways
mby01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mby00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    MSBRM_0158
Enzymes [BR:mby01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.-  
     MSBRM_0158
SSDB
Motif
Pfam: NAD_binding_2 NAD_binding_7 2-Hacid_dh_C UDPG_MGDP_dh_N 3HCDH_N
Other DBs
NCBI-ProteinID: AKB53156
UniProt: A0A0E3LMK0
LinkDB
Position
169071..169850
AA seq 259 aa
MALLTPNDLININKQLQEADSVVKRVTGLDIKGVCQSLYGTSPSSKKVGIVPVTSGNGII
GNFSASLHVITQYFGFDGFVTDMPDVSGYYEAVQNGAEIILMADDHTFLAHNIKNGKMAN
NQPCTGIIYAEIASRYLKADSKDVLVMGLGKVGFPGAAQLVQKGFRVYGYDPDARLLKRA
VSNLGIIPFDPANPKKFSIIFEATPCANTIPEAVLSENCVLSTPGIPCAISEELKNKYDV
QLVAEPLGIGTVSMLYSVL
NT seq 780 nt   +upstreamnt  +downstreamnt
atggcacttttaacccccaatgatttgataaatattaataagcagcttcaggaagctgac
tctgtcgtgaaaagagtaacagggcttgatataaaaggcgtctgtcaatctctttatggt
acttcccctagctccaaaaaagtaggcatcgtgcctgtaacttcaggaaacgggataata
ggaaacttctcggcttccttacatgtaattacgcagtatttcggatttgacggttttgtt
acggatatgccggatgttagcggctattatgaagctgtgcagaacggagccgagatcatc
cttatggcagacgatcacactttccttgctcataacatcaaaaatggaaaaatggccaat
aatcaaccctgcacaggtataatttatgctgagatcgcttccagatacctgaaagccgac
tcaaaggacgtacttgttatggggctcggaaaggtaggttttcccggagcagcccaactt
gtgcagaaaggcttcagggtttacgggtatgatcctgatgcaagactccttaagagagcc
gtttcaaacctcgggattattcctttcgaccctgcgaatccaaaaaagttttccattatc
ttcgaggcgaccccatgcgcaaacacgattcctgaagctgtactttcggagaattgcgtg
ctttccaccccaggaattccctgcgcaatttctgaagaacttaaaaataaatatgatgtt
caacttgtagcggagccccttggaataggaacggtatcaatgttgtattctgtgctctaa

DBGET integrated database retrieval system