KEGG   Methanosarcina barkeri MS: MSBRM_2348Help
Entry
MSBRM_2348        CDS       T03838                                 

Definition
(GenBank) cell surface protein
Organism
mby  Methanosarcina barkeri MS
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PKD Beta_helix NosD MG2 PKD_3 ChitinaseA_N Ub-RnfH
Motif
Other DBs
NCBI-ProteinID: AKB55346
UniProt: A0A0E3LNT8
LinkDB All DBs
Position
3084537..3086633
Genome map
AA seq 698 aa AA seqDB search
MIFGEEFKIFCDSACPFFFYIILSSPAALATNIVIDKQTGPAESDLFHTTNYANDAACIQ
AALDKSKSGDTITIHEGNYYITKIIYQNGKNLKIIGEGKVIFHMKNPEKETYGILFRGSL
IANKKLNTNANKGSSQVVLTDASRVRKNDLIKIWKNVKWCPHDYSDQMTGEIYAVKNVNG
NVVTLNQPLHRDYKLSENVKVEVYRPIQMNIKNIRIQGRGATTSHRGLAMQYCKDSSITN
SWFKDIGFSAICLYSCFNVNINNNEIYNSLLPGSGYGVNVASGSAFVNIDHNHIENCRHA
ITGNTAERKSLNRDVFITDNTLIGGNIDGSSVVDSHPVTISYVVTKNKIYPQPGFFAFSD
GTQYSTFSNNKIFGGYGGISRRGSINDGIHSYENNKFNGMSGIMYLGGKSGINNKLIIKN
NVQNNGIYGIYFPGQESFRNIIISGNSFSNLSHKGVYQKFRINGVNLNISNNRFTDIKLN
GIHIDGNSFKSNIVKIQNNILINVYPPNLSYGIIVKNVQNAIITGNKISKTQKPSVPVAT
FYASPKSGTVPLSVKFTDKSTGKPTKWKWSFGDGKSSTAKNPTHKYSKAGKYTVKLTVTN
AAGSNTAMKSKYIIVTAKPVAVFYASPKSGKVPLSVKFTDKSTGKPTKWKWSFGDGTYST
AQNPTHKYSKKGKYTVKLTVASSAGSNTATKTTYIKIS
NT seq 2097 nt NT seq  +upstreamnt  +downstreamnt
gtgatttttggtgaggagtttaagattttttgtgacagtgcttgccctttctttttttat
attattttaagcagccctgcagctttggcgacaaacatcgtaattgacaaacagactgga
ccagctgaatcagatctttttcatacaactaattatgcaaacgatgcagcctgcattcag
gcggcactggataaatcaaaaagtggggatacaattactatccatgaagggaactactat
attacaaaaataatatatcaaaatggtaaaaatctgaaaataataggcgaaggaaaagta
atttttcacatgaaaaatccggaaaaagaaacttacgggattttattccgtggatcattg
atcgcaaacaaaaaattgaacactaatgccaataagggctcatctcaagtggttttaact
gatgcttcaagggttcgcaagaacgacctgataaaaatatggaaaaatgtcaagtggtgt
cctcatgattattctgatcaaatgacaggggaaatttacgctgttaaaaatgtgaatgga
aatgttgtcactttaaatcaaccactccatagagattacaaattatctgagaatgtaaag
gtcgaagtatacagacctattcaaatgaatataaagaacataaggatacagggtagaggt
gcaacgacatctcatcgtggactggctatgcaatattgcaaggacagttctattactaat
tcttggttcaaagatattggattcagtgctatttgcctgtattcctgttttaatgtgaat
attaataataatgagatttacaattcacttcttccaggaagtggatatggcgtaaatgtg
gctagcggttcggcttttgtcaatattgaccataatcacatagaaaactgcaggcatgct
ataacaggcaatacagctgaacgcaaatctttaaatcgtgatgtttttatcactgataac
actctaatagggggaaacatcgatggttctagtgttgttgattcccatcctgttactatt
agctatgtcgtaactaaaaacaaaatatacccgcaaccaggctttttcgctttttcagat
ggcacacaatattcgacattttctaacaacaaaatttttggcggatatggaggtatatcc
agacgcggcagcattaatgatggaatacatagttacgaaaataataaatttaatggtatg
tcaggtattatgtatctgggaggaaaaagtggaatcaataacaagcttataattaaaaat
aatgttcaaaacaatgggatatatggaatttattttccaggtcaggagagtttcaggaat
ataataataagtgggaacagtttcagcaatctttcgcataaaggagtatatcagaagttt
agaattaacggagtaaacttaaatatctctaataataggtttacagacataaaactgaat
ggaatacatatagatggaaattcgttcaaaagtaacattgtgaagatacaaaacaacatc
ttaataaatgtgtatccaccgaatctctcttatggaatcatagtaaaaaatgttcaaaat
gccataattactggaaataagatatcaaaaacccaaaaacccagcgttcctgttgctaca
ttttatgcatctccaaaatcaggaacagtacctttaagcgtgaaatttactgacaaaagt
acaggaaaaccaactaaatggaaatggagtttcggagacggaaaatcgtcaacagccaaa
aatccaactcataagtattctaaagcaggaaaatatactgttaaacttacagtaacaaat
gctgcaggcagtaacacagcaatgaaatcaaagtatatcatagtgacagcaaaaccggtt
gctgtattttatgcatctccaaaatcaggaaaagtacctttaagtgtgaaatttactgat
aaaagtacaggaaaaccaactaaatggaaatggagttttggagatgggacatattcaaca
gcccagaatccaactcataagtattccaaaaaagggaaatatactgttaaacttacagta
gccagttctgcaggtagcaatacagcgacaaagacaacatatattaaaatttcataa

DBGET integrated database retrieval system