KEGG   Methanosarcina barkeri MS: MSBRM_2614Help
Entry
MSBRM_2614        CDS       T03838                                 

Definition
(GenBank) hypothetical protein
Organism
mby  Methanosarcina barkeri MS
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AKB55612
UniProt: A0A0E3QXS1
LinkDB All DBs
Position
3433466..3436615
Genome map
AA seq 1049 aa AA seqDB search
MKKKTGIYNEIFSRKWRLIFITLVLIFSVISISATGAGSQTNSQARDKVVHESNIGVSNE
TEDNYLYYIVDENYTEVNCFDCMENDEDNNTKDDYSSCTKSDKNYTDKCSYCIEDEENLE
QKVGENKSKENQETGENNTKLETGTGKSTETKEKVENSTKSETEKNTTTQKTVENNTKSE
TGTEAGKNTTTQKTVENNTKLETETGKNTTTQETGENNTKSKTETEAGKNTTTQETIENN
TKSKTETEAGKNTTTQETIENNTKSKTETEAGKNTTTQKTVENNTKLETETEAGKNTTTQ
ETIENNTKSKTETEAGKNTTTQETGEDIEQETDLADSILHYKVYKIEENKSKENQETGEN
NTKSKTETGKNTDSKENIKGNESKNSEANVSNLKYKTITVNETVERENKSESNDTDSKEN
IKKRSKNSEANISNWYKTITVNKTVERENKSESNDTDSKENIEKNESKNSEANVSNWYKT
TTVNKTVDQENESESNNTDSQENIGEDNQKSSKSGGSNCKCKIIASNKTVAQENESKSSE
NNVSNLKYKIITVNRTITQNNTKTKNETKNETINESKSLKSTEVETKNRTKTSNGISNET
SNGTSNGTSNGISNETSNGTSNGTSNSTKSVESEVLSPEVNWTVASQEVNKIKVYNWTGS
QGNESVTPKVKTERNSWNNIKFILSYSYPLRSFYTTKDNVNISYNGPGTLGQQKVDIYLI
KEYSPSSPENEILYGTNKSTISLEDVLNNDTEAYVKIPATLNKEGDLTPLTLDPLQAGHY
WIIMTPAGNETEKTGSEKEVLLAKYFEVLKYQMEDRSPYALQEGKNLDVNLDLKNATAEK
NYTYWAIMIKDGAYTAFEGTNPRWRMNTGIRPIVNGVDLIKVLETNLSKYESKNGKDELQ
NEIQTLIGKDNGTISIGEKTQSNLSLKSLELPPGDYLLLTGTYGNNEGLTGITQKKLRIS
PKSLSGLGLNPSSENTFGDESSKKFKASPLMEIKSLLENPKSFILEDVKPYIQANSLAEV
LRNPPKLPSFLLGFAVTLLVGFAVLRKKK
NT seq 3150 nt NT seq  +upstreamnt  +downstreamnt
ttgaagaaaaaaacaggaatttataatgaaatatttagcagaaagtggagattaatcttc
attactctggttctaattttttcagtaatttcaatatcagctacaggagcgggaagccaa
accaacagccaggcaagagacaaagtagtacatgagtcaaacattggagtaagtaacgag
acagaagataattatttgtattatatagtagacgaaaattataccgaagttaattgcttt
gactgcatggaaaatgatgaagataacaatacaaaagatgattattcttcctgcacaaaa
agtgacaaaaattataccgataaatgctcttactgcatagaagatgaagaaaatcttgaa
caaaaagtaggagaaaacaaaagtaaggaaaatcaagaaacaggagaaaataatactaaa
ttagaaacaggaacaggaaaaagtacagaaacaaaagaaaaagtggaaaatagtactaaa
tcagaaacagaaaaaaatacaacaactcaaaaaacagtagaaaataatactaaatcagaa
acaggaacagaagcaggaaaaaatacaacaactcaaaaaacagtagaaaataatacaaaa
ttagaaacagaaacaggaaaaaatacaacaactcaagaaacaggagaaaataatactaaa
tcaaaaacagaaacagaagcaggaaaaaatacaacaactcaagaaacaatagaaaataat
actaaatcaaaaacagaaacagaagcaggaaaaaatacaacaactcaagaaacaatagaa
aataatactaaatcaaaaacagaaacagaagcaggaaaaaatacaacaactcaaaaaaca
gtagaaaataatacaaaattagaaacagaaacagaagcaggaaaaaatacaacaactcaa
gaaacaatagaaaataatactaaatcaaaaacagaaacagaagcaggaaaaaatacaaca
actcaagaaacaggagaagacattgagcaagagactgacctagctgactctattttacat
tacaaagtgtataaaatagaagaaaacaaaagtaaggaaaatcaggaaacaggagaaaat
aatactaaatcaaaaacagaaacaggaaaaaatacagatagcaaagaaaatatcaaagga
aatgaatcaaaaaattcagaagctaatgtatctaatttgaaatataaaacaataacagta
aatgaaacagttgaaagggaaaacaaatcagaaagtaacgatacagatagcaaagaaaat
ataaaaaaacgatcaaaaaattcagaagctaatatatctaactggtataaaacaataaca
gtaaataaaacagttgaaagggaaaacaaatcagaaagtaacgatacagatagcaaagaa
aatatcgaaaaaaacgaatcaaaaaattcagaagctaatgtatctaactggtataaaaca
acaacagtaaataaaacagttgatcaggaaaacgaatcagaaagtaacaatacagatagc
caagaaaacatcggagaagataaccaaaaaagttcaaaaagtggtgggtctaactgtaaa
tgcaaaataatagcatcaaataaaacagttgctcaagaaaatgaatcaaaaagttcagaa
aacaatgtatctaatttgaaatataaaataataacagtaaatagaaccatcacccaaaac
aataccaaaacgaaaaatgaaacaaaaaatgaaacaatcaatgagtcgaaaagtctgaaa
agtacagaagtggaaactaaaaatagaaccaaaacctcaaatgggatctcaaacgaaact
tcaaatggaacctcaaacgggacctcaaatggaatctcaaacgaaacttcaaatggaacc
tcaaatggaacttcaaacagcacaaaaagtgtggaaagcgaagtattgagccctgaagta
aactggacggtggcaagtcaggaagtaaataaaataaaagtatataattggacaggcagt
cagggaaacgagtctgtaacacctaaggtaaaaaccgagagaaatagctggaacaatatt
aaatttatactgtcgtattcatatccacttcgttcgttttataccacaaaagacaatgtg
aatataagttataatggacctggaactttagggcagcagaaagtagacatttacctcatc
aaggaatacagcccgagttctccggaaaatgagattttatatggtacaaataaaagcacg
attagtcttgaagatgtcttaaacaatgatacagaagcttatgtaaagatacctgcgacc
ctgaacaaagaaggagaccttactcccctgacactggaccctcttcaggcaggccactac
tggatcattatgacccctgcaggaaacgaaacggaaaaaacaggatcggaaaaagaggtt
cttttagcaaaatattttgaagttctcaaataccaaatggaagacagatctccatatgcc
cttcaagaaggcaaaaacttagacgttaacctggatctgaagaatgcgaccgctgagaag
aattatacttactgggctataatgataaaagatggtgcctatacagcatttgaaggcaca
aacccaagatggagaatgaacaccggaatcagacctatcgtgaacggagttgaccttatc
aaggttttggaaaccaatttgagtaaatatgaatccaaaaacggaaaagatgaacttcag
aatgagatccagacccttatagggaaagataacggtacgataagcataggtgagaaaacc
cagagtaacctttccctgaaaagtttggaacttcccccaggagactatctcctccttaca
ggaacctatggaaataatgaaggcttgacaggtataacccagaaaaaactgagaatatcc
cccaaaagcttatctggattaggcttgaaccccagctcagaaaataccttcggtgatgaa
tcttcaaagaaattcaaagcatctccacttatggaaattaagtctcttctcgaaaatcca
aaatcattcatactcgaagatgtcaagccatatattcaagcaaactcattagcagaagtc
ttacgaaatcctccaaaacttccctccttcttgttgggctttgcagtaaccctactggta
ggattcgcagtgctgaggaaaaagaaatga

DBGET integrated database retrieval system