KEGG   Mycobacterium bovis ATCC BAA-935: LH58_01835Help
Entry
LH58_01835        CDS       T03363                                 

Definition
(GenBank) aminotransferase
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
mbz  Mycobacterium bovis ATCC BAA-935
Pathway
mbz00220  Arginine biosynthesis
mbz00250  Alanine, aspartate and glutamate metabolism
mbz00290  Valine, leucine and isoleucine biosynthesis
mbz01100  Metabolic pathways
mbz01110  Biosynthesis of secondary metabolites
mbz01130  Biosynthesis of antibiotics
mbz01210  2-Oxocarboxylic acid metabolism
mbz01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mbz00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    LH58_01835
   00290 Valine, leucine and isoleucine biosynthesis
    LH58_01835
   00220 Arginine biosynthesis
    LH58_01835
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mbz01007]
    LH58_01835
Enzymes [BR:mbz01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     LH58_01835
    2.6.1.66  valine---pyruvate transaminase
     LH58_01835
Amino acid related enzymes [BR:mbz01007]
 Aminotransferase (transaminase)
  Class I
   LH58_01835
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Cys_Met_Meta_PP Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: AIR45618
UniProt: A0A083WL67
LinkDB All DBs
Position
complement(402094..403383)
Genome map
AA seq 429 aa AA seqDB search
MDNDGTIVDVTTHQLPWHTASHQRQRAFAQSAKLQDVLYEIRGPVHQHAARLEAEGHRIL
KLNIGNPAPFGFEAPDVIMRDIIQALPYAQGYSDSQGILSARRAVVTRYELVPGFPRFDV
DDVYLGNGVSELITMTLQALLDNGDQVLIPSPDYPLWTASTSLAGGTPVHYLCDETQGWQ
PDIADLESKITERTKALVVINPNNPTGAVYSCEILTQMVDLARKHQLLLLADEIYDKILY
DDAKHISLASIAPDMLCLTFNGLSKAYRVAGYRAGWLAITGPKEHASSFIEGIGLLANMR
LCPNVPAQHAIQVALGGHQSIEDLVLPGGRLLEQRDIAWTKLNEIPGVSCVKPAGALYAF
PRLDPEVYDIDDDEQLVLDLLLSEKILVTQGTGFNWPAPDHLRLVTLPWSRDLAAAIERL
GNFLVSYRQ
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
gtggacaacgatggcaccattgtggacgtgacaacccaccagctgccctggcacaccgcc
agccatcagcggcagcgcgccttcgctcagtcggccaagctgcaggacgtcctgtacgag
atccgcggcccggtgcaccagcacgccgcgcggctcgaagccgaaggtcaccgcatcctc
aaactcaacatcggcaacccggcgccgttcggcttcgaagcacccgacgtgatcatgcgc
gatatcatccaggcgctgccctacgcgcaggggtactccgactcgcagggcatcctgtcg
gcccggcgtgcggtggtcacgcgctacgagctggtgcccggatttccccgattcgacgtg
gacgacgtctacctgggtaacggggtctccgagctgatcacgatgacgctgcaagccctg
ctggacaacggcgatcaggtgctgattccatcaccggactacccgctgtggacggcgtcg
acctcgctggctggcggcactccggtccactacctgtgcgatgagacccaaggctggcag
cccgatatcgccgacctggaatccaagatcaccgagcgcaccaaggcgctggtcgtgatc
aaccccaacaacccaaccggcgcggtgtacagctgcgaaatcctcacccagatggtcgat
ctggcccgcaagcatcaactgctgctgttggcggacgaaatctacgacaaaatcctctac
gacgacgccaagcacatcagcctggcatcgatcgccccggatatgttgtgcctgaccttc
aatgggctgtcgaaggcctaccgcgtcgccggataccgggccggctggctggcgatcacc
ggacccaaggagcacgccagcagcttcatcgagggcatcggcctgctggccaatatgcgg
ttgtgcccaaatgtcccggcccagcatgccattcaggttgcactgggcggccatcagagc
atcgaggacctggtgctgcccggcggccggctgctcgagcagcgcgacatcgcctggacc
aagctcaacgagatcccgggggtgtcgtgcgtcaaaccggcgggcgcgctgtatgcgttt
ccccggctagaccccgaggtctacgacatcgacgacgacgagcaactcgtgctcgatctg
ctgctgtcggagaagatcctggtcacccagggcaccgggttcaactggcccgcaccggat
catctgcgcctggtgacgctgccatggtcccgcgatctggcggccgccatcgagcggctg
ggtaacttcctggtcagttaccggcaatag

DBGET integrated database retrieval system