KEGG   Mycobacterium bovis ATCC BAA-935: LH58_13815Help
Entry
LH58_13815        CDS       T03363                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
mbz  Mycobacterium bovis ATCC BAA-935
Pathway
mbz00250  Alanine, aspartate and glutamate metabolism
mbz00280  Valine, leucine and isoleucine degradation
mbz00410  beta-Alanine metabolism
mbz00640  Propanoate metabolism
mbz00650  Butanoate metabolism
mbz01100  Metabolic pathways
mbz01120  Microbial metabolism in diverse environments
Module
mbz_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:mbz00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    LH58_13815
   00650 Butanoate metabolism
    LH58_13815
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    LH58_13815
   00280 Valine, leucine and isoleucine degradation
    LH58_13815
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    LH58_13815
Enzymes [BR:mbz01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     LH58_13815
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     LH58_13815
Amino acid related enzymes [BR:mbz01007]
 Aminotransferase (transaminase)
  Class III
   LH58_13815
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: AIR47820
UniProt: A0A083W124
LinkDB All DBs
Position
2837115..2838464
Genome map
AA seq 449 aa AA seqDB search
MASLQQSRRLVTEIPGPASQALTHRRAAAVSSGVGVTLPVFVARAGGGIVEDVDGNRLID
LGSGIAVTTIGNSSPRVVDAVRTQVAEFTHTCFMVTPYEGYVAVAEQLNRITPGSGPKRS
VLFNSGAEAVENAVKIARSYTGKPAVVAFDHAYHGRTNLTMALTAKSMPYKSGFGPFAPE
IYRAPLSYPYRDGLLDKQLATNGELAAARAIGVIDKQVGANNLAALVIEPIQGEGGFIVP
AEGFLPALLDWCRKNHVVFIADEVQTGFARTGAMFACEHEGPDGLEPDLICTAKGIADGL
PLSAVTGRAEIMNAPHVGGLGGTFGGNPVACAAALATIATIESDGLIERARQIERLVTDR
LTTLQAVDDRIGDVRGRGAMIAVELVKSGTTEPDAGLTERLATAAHAAGVIILTCGMFGN
IIRLLPPLTIGDELLSEGLDIVCAILADL
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
gtggccagcctgcagcagagtcggcgcctggtcaccgaaatccccggtcccgcatcgcag
gcactgactcaccgccgggcggcggcggtgtccagcggtgttggggtcaccctgccggtg
ttcgtagcccgcgccggcggcggcatcgtggaagacgtggacggtaaccggctcatcgac
ctgggttcgggcatcgcagtgacgacgatcggcaactcgtcgccacgcgtggtggatgcg
gtgcgcacgcaggtggccgaatttacccacacctgcttcatggtgacgccatacgagggg
tacgtggccgtcgccgagcaactcaaccggattaccccaggttcgggccccaagcgctcg
gtgttgttcaattccggcgccgaggcagtcgagaacgccgtcaagatcgcacgctcctac
accggcaagcccgcggtggtggcgttcgaccacgcctaccacggtcgcaccaacctaacg
atggcgctgaccgccaagtcgatgccctacaagagcggcttcggtccgttcgcgccggag
atctaccgagcgccattgtcttacccctatcgggacggcctcctcgataagcaactggct
accaatggtgagctagccgcggcccgagccatcggcgtcatcgacaagcaggtaggcgcg
aacaacctggccgccctcgtcatcgaaccgatccagggcgaaggcggtttcatcgttccg
gccgaagggttcctacctgccctcctcgattggtgccgcaagaaccatgtggtgttcatc
gccgacgaggtgcaaaccggctttgcccgtaccggggcgatgttcgcctgcgagcacgag
ggccccgacggtctagagcccgacctgatctgcacggccaaaggcatcgccgatggattg
ccgctgtcggcggtcaccggccgcgccgagatcatgaacgccccgcacgtgggcggcctg
ggcggcacgttcggcggcaacccggtggcctgtgcggccgcgctggccaccatcgcaacc
atcgaaagcgacgggctgatcgagcgggcccgccagatcgaacgcctggtgaccgaccgg
ttgacgacgctgcaggccgtcgacgaccggatcggcgacgtgcgtggtcgcggcgccatg
atcgccgtagagctggtcaaatccggaaccaccgagcccgacgccgggctgaccgagcgg
ctggcgaccgcggcccacgccgccggcgtcatcattttgacctgcggcatgttcggcaac
atcatccggctactgccgccgctgaccatcggcgacgagctgctgagtgaggggctggac
atcgtgtgcgcgatcttggccgacctctga

DBGET integrated database retrieval system