KEGG   Mycobacterium bovis ATCC BAA-935: LH58_18605Help
Entry
LH58_18605        CDS       T03363                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
mbz  Mycobacterium bovis ATCC BAA-935
Pathway
mbz00473  D-Alanine metabolism
mbz01100  Metabolic pathways
mbz01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:mbz00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    LH58_18605
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    LH58_18605
Enzymes [BR:mbz01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     LH58_18605
Peptidoglycan biosynthesis and degradation proteins [BR:mbz01011]
 Precursor biosynthesis
  Racemase
   LH58_18605
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: AIR48710
LinkDB All DBs
Position
complement(3816777..3817937)
Genome map
AA seq 386 aa AA seqDB search
MAMTPISQTPGLLAEAMVDLGAIEHNVRVLREHAGHAQLMAVVKADGYGHGATRVAQTAL
GAGAAELGVATVDEALALRADGITAPVLAWLHPPGIDFGPALLADVQVAVSSLRQLDELL
HAVRRTGRTATVTVKVDTGLNRNGVGPAQFPAMLTALRQAMAEDAVRLRGLMSHMVYADK
PDDSINDVQAQRFTAFLAQAREQGVRFEVAHLSNSSATMARPDLTFDLVRPGIAVYGLSP
VPALGDMGLVPAMTVKCAVALVKSIRAGEGVSYGHTWIAPRDTNLALLPIGYADGVFRSL
GGRLEVLINGRRCPGVGRICMDQFMVDLGPGPLDVAEGDEAILFGPGIRGEPTAQDWADL
VGTIHYEVVTSPRGRITRTYREAENR
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
ttggccatgacaccgatatcccagacacctggcctcctcgccgaggccatggtggatctg
ggcgctattgaacacaacgtgcgggtgctgcgtgagcacgccggccacgcgcagctgatg
gcggtggtcaaggccgacggctacggtcacggtgctacgcgcgtcgcccaaaccgccctg
ggagccggtgcggccgaactcggcgtcgccaccgtcgacgaggcgctagcgctgcgcgct
gatggcattaccgcaccggtgctggcctggctgcatccgcccggcatcgacttcgggccc
gcgctgctggccgacgtgcaggtcgcggtgtcctcgctgcgccaactcgacgaactgttg
cacgcggtgcgccggaccggccggacggcgacggtgaccgtcaaggtggataccgggctg
aaccgcaatggcgtgggaccggcacaattcccggccatgctgaccgcgttacgccaagcc
atggccgaggacgccgtccggctgcgggggctgatgtcgcatatggtttacgccgacaag
cctgacgattccatcaacgatgttcaggcccaacggtttaccgcctttctggcgcaggcc
cgcgaacaaggggtgcggttcgaggtggcgcatctatcgaactcatcagcaactatggcg
cgccccgacctgacgttcgacctggtgcggccgggcatcgcggtgtatgggctaagcccg
gtacccgccctcggtgacatggggctggtgccggcgatgaccgtgaaatgtgctgttgcg
ctggtgaaatcgattcgtgcgggggagggcgtgtcgtatgggcacacatggatcgcgcca
cgcgacaccaatctggcgctgctgccgatcggttacgcagacggcgtgttccggtcgctg
ggcgggcggctggaggtgctgatcaacggcagacgatgccccggtgtggggcggatctgc
atggaccagttcatggtcgacctgggccccgggccgcttgatgtggccgaaggcgacgag
gcgattttgttcgggccgggcatccggggtgagcccacggctcaggactgggccgatctt
gtcggcaccatccactacgaagtggtcaccagcccgcgaggacgtatcaccaggacctat
cgcgaggctgaaaaccgttga

DBGET integrated database retrieval system