KEGG   Methylococcus capsulatus: MCA0074Help
Entry
MCA0074           CDS       T00205                                 

Gene name
gst
Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
mca  Methylococcus capsulatus
Pathway
mca00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:mca00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    MCA0074 (gst)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mca02000]
    MCA0074 (gst)
Enzymes [BR:mca01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     MCA0074 (gst)
Transporters [BR:mca02000]
 Other Transporters
  Pores ion channels [TC:1]
   MCA0074 (gst)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_2 GST_N_3 GST_C GST_C_3 GST_C_2
Motif
Other DBs
NCBI-ProteinID: AAU90767
UniProt: Q60CN1
LinkDB All DBs
Structure
PDB: 

Position
76264..76875
Genome map
AA seq 203 aa AA seqDB search
MKLYYFPGACSLAPHIVLREAGLDFELENVDLGTKKTGSGADFLQVNPKGYVPALQLDDG
QVLTEDQVILQYLADLKPESGLMPPSGTFERYRLLEWLAFISTEIHKTFGPFWNPESPEA
SKQIALGLLSRRLDYVEDRLEAGGPWLMGDRYSVADAYLSTVLGWCEYLKIDLSKWPRIL
AYLERNQARPAVQAAMKAEGLIQ
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgaaactctactatttccccggtgcctgttccctggcgccccacatcgtgctgcgcgaa
gcgggtctggatttcgagctggagaacgtcgatctcggcaccaagaagaccggcagcggc
gcggactttctccaggtcaatcccaagggctacgtaccggcattgcagctggacgatggc
caggtgctgaccgaggaccaggtcatcctgcaatacctcgcggacctcaagcccgagtcc
ggcctgatgccgccgtcggggacgttcgagcgctaccggctcctggagtggctggccttc
atctccaccgagatccacaaaaccttcggcccgttctggaatccggaatctcccgaggcc
agcaagcagatcgcgctcgggctgctgtcgcggaggctggattacgtggaagaccggctg
gaggcgggcggtccctggctgatgggggaccgctacagcgtggccgatgcttatctctct
accgtgctgggttggtgcgaatacctcaagatcgatctctcgaagtggccgcgcatcctc
gcctatctcgaacgcaaccaggcgcggccagcagttcaggccgctatgaaggccgaaggg
ttgatccaataa

DBGET integrated database retrieval system