KEGG   Methylococcus capsulatus: MCA2426Help
Entry
MCA2426           CDS       T00205                                 

Gene name
ddL
Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
mca  Methylococcus capsulatus
Pathway
mca00473  D-Alanine metabolism
mca00550  Peptidoglycan biosynthesis
mca01100  Metabolic pathways
mca01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:mca00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    MCA2426 (ddL)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    MCA2426 (ddL)
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    MCA2426 (ddL)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:mca01011]
    MCA2426 (ddL)
Enzymes [BR:mca01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     MCA2426 (ddL)
Peptidoglycan biosynthesis and degradation proteins [BR:mca01011]
 Precursor biosynthesis
  Amino acid ligase
   MCA2426 (ddL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp ATPgrasp_YheCD TTL ATPgrasp_Ter ATP-grasp_4 ATPgrasp_ST
Motif
Other DBs
NCBI-ProteinID: AAU91482
UniProt: Q604W0
LinkDB All DBs
Position
complement(2603618..2604547)
Genome map
AA seq 309 aa AA seqDB search
MEKRIQQASKFGKVAVLMGGSAAEREISLKSGKAVLEALRSGGIDAEGIDVGRDLIAPLL
ERRFDRVFNVIHGRGGEDGVLQGALACLRVPCTGSGVLASALSMDKLRTKLCWTGAGLPT
PPWLRLDSPDDLERCRQALGFPVIVKPAEEGSSIGMSRAATAEELAQAWERASGYGCAVF
AERWIDGVEYTGGMLKGVPLPLIRLETPHAFYDFDAKYRADTTRYHCPCGLDTGREAELQ
ALVLRACQIVGVSGWGRVDLLVDRSGQPWLIEVNTVPGMTDHSLVPMAAKAAGIDFQELV
WHILETSFA
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
gtggaaaaaaggattcagcaggcatcaaagtttggcaaggtcgcggtcctgatgggcggt
tcggcggccgaacgggagatttcgctgaaaagcggcaaggccgttttggaagcattgcgg
agcggcgggatcgatgccgaaggtatcgatgtcgggcgcgacctgatcgccccgttgctg
gagcgccgcttcgaccgggtgttcaatgtcattcacggccgcggcggcgaggacggcgtg
ctgcagggcgccctcgcttgtttgagggttccttgcaccggaagcggtgtgctggcttcc
gcgctgagtatggacaaactgcgtaccaaactgtgctggacgggagccggtctgccgacc
cccccctggctgcgcctggattcgcccgacgatctcgagcgttgccgccaggcattgggt
ttcccggtgatcgtcaagccggcggaagaggggtcgagcataggcatgagccgtgctgcg
acggccgaagaactggcacaggcctgggagcgtgcctccggttacggctgtgccgttttc
gccgaacgctggatcgacggcgtcgaatacaccggcggcatgctcaagggtgtgccgttg
ccgctgatccgcctggaaaccccacacgccttctatgatttcgatgccaaataccgggcc
gacaccacccgttaccactgtccgtgcggactggacaccgggcgcgaggccgaactgcag
gcgctggtgctgcgggcctgccagatcgtcggcgtcagcggctggggtcgggtcgacctg
ctggtggaccgcagcggccagccctggctgatcgaggtcaataccgtgcctggcatgacg
gatcacagtctcgttccgatggccgccaaggccgcaggcatcgattttcaggagctggtg
tggcacatcctggaaaccagcttcgcctga

DBGET integrated database retrieval system