KEGG   Methylococcus capsulatus: MCA2743Help
Entry
MCA2743           CDS       T00205                                 

Gene name
cbbL
Definition
(GenBank) ribulose bisphosphate carboxylase, large subunit
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
mca  Methylococcus capsulatus
Pathway
mca00630  Glyoxylate and dicarboxylate metabolism
mca01100  Metabolic pathways
mca01120  Microbial metabolism in diverse environments
mca01200  Carbon metabolism
Module
mca_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:mca00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    MCA2743 (cbbL)
Enzymes [BR:mca01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     MCA2743 (cbbL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: AAU91176
UniProt: Q603Q7
LinkDB All DBs
Position
2934677..2936098
Genome map
AA seq 473 aa AA seqDB search
MAVKTYNAGVKEYRETYWDPNYTPADTDLLAVFKITPQPGVPREEAAAAVAAESSTGTWT
TVWTDLLTDLDYYKGRAYRIEDVPGQDEQFYAFIAYPIDLFEEGSVVNVFTSLVGNVFGF
KAVRGLRLEDVRFPLAYVMTCGGPPHGIQVERDIMNKYGRPLLGCTIKPKLGLSAKNYGR
AVYECLRGGLDFTKDDENVNSQPFMRWRQRFDFVMEAIEKAEAETGERKGHYLNVTAPTP
EEMYKRAEYAKEIGAPIIMHDFITGGFCANTGLANWCRNNGMLLHIHRAMHAVMDRNPNH
GIHFRVFTKMLRLSGGDHLHTGTVVGKLEGDRQATLGWIDLLRERSIKEDRSRGIFFDQE
WGAMPGVFAVASGGIHVWHMPALLSIFGDDAVFQFGGGTLGHPWGNAAGAAANRVALEAC
VEARNEGRQLEKEGKEILTEAAKSSPELKAAMETWKEIKFEFDTVDKLDVAHR
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atggctgtcaaaacatacaacgcgggcgtcaaggaataccgcgaaacctactgggacccg
aactacactcccgccgacaccgatctgctggcggtcttcaagatcacccctcagccgggt
gtgccgcgcgaagaagccgccgccgccgtggccgcggaatcgtcgaccggcacctggacc
accgtctggaccgacctgctgaccgacctcgactattacaagggccgcgcctaccggatc
gaggacgtgcccggccaggacgaacagttctacgccttcatcgcctatcccatcgacctg
ttcgaggagggctccgtcgtcaacgtgttcacctcgctggtgggcaacgtgttcggcttc
aaggccgtgcgcggcctgcgcctggaagacgtgcgcttccccctcgcctacgtgatgacc
tgcggcggcccgccccacggcatccaggtggagcgcgacatcatgaacaagtacggccgt
ccgttgctcggctgcaccatcaagcccaagctgggcctgtcggccaagaactacggccgc
gccgtgtacgagtgcctcagaggcggcctggacttcaccaaggacgacgagaacgtcaac
agccagccgttcatgcgctggcgccagcgcttcgacttcgtgatggaggcgatcgagaag
gccgaggccgaaaccggcgagcgcaagggccactacctcaacgtgaccgccccgactccg
gaagagatgtacaaacgtgccgagtacgccaaggaaatcggcgcgcccatcatcatgcac
gacttcatcaccgggggcttctgcgccaacacgggtctcgccaactggtgccgcaacaac
ggcatgctgctgcacatccaccgcgccatgcacgccgtgatggaccgcaatcccaaccac
ggcatccacttccgcgtcttcaccaagatgctgcgcctttctggcggcgaccatctgcac
accggcaccgtggtcggcaagctggaaggcgaccgccaggccaccctggggtggatcgac
ctgctgcgcgaacgcagcatcaaggaagaccgcagccgcggcatcttcttcgaccaggaa
tggggcgccatgcccggcgtgttcgcggtcgcctccggcggcatccacgtctggcacatg
ccggcactgctttcgatcttcggcgacgacgcggtgttccagttcggtggcggcaccctg
ggccatccttggggcaacgcggccggcgccgctgccaaccgcgtggcgctggaagcctgc
gtggaggcccgcaacgaaggccgccagctcgagaaggaaggcaaggaaatcctgaccgaa
gccgccaagagcagcccggaactcaaggccgcaatggagacctggaaggaaatcaaattc
gagttcgacaccgtcgacaagctcgacgtggcccaccggtaa

DBGET integrated database retrieval system