KEGG   Micromonospora carbonacea: HXZ27_06180
Entry
HXZ27_06180       CDS       T06722                                 

Gene name
rosQ
Definition
(GenBank) dTDP-4-dehydro-6-deoxyglucose aminotransferase
  KO
K13308  dTDP-4-amino-4,6-dideoxy-D-glucose transaminase [EC:2.6.1.33]
Organism
mcab  Micromonospora carbonacea
Pathway
mcab00523  Polyketide sugar unit biosynthesis
mcab01100  Metabolic pathways
mcab01110  Biosynthesis of secondary metabolites
Module
mcab_M00797  dTDP-D-desosamine biosynthesis
Brite
KEGG Orthology (KO) [BR:mcab00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    HXZ27_06180 (rosQ)
Enzymes [BR:mcab01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.33  dTDP-4-amino-4,6-dideoxy-D-glucose transaminase
     HXZ27_06180 (rosQ)
SSDB
Motif
Pfam: DegT_DnrJ_EryC1 Aminotran_1_2 SHMT Cys_Met_Meta_PP
Other DBs
NCBI-ProteinID: QLD23845
LinkDB
Position
1418242..1419468
AA seq 408 aa
MKRDLGDLALFGGHASFLQQIHVGRPNRIDRARLFDRLSWALDNEWLTNNGPLAREFEER
VADMVGVGNCVATCNATVALQLLAHATELTGEVIMPSLTFAATAHAVRWLGLEPVFCDID
PRTGCLDHVAVAAAITPRTSAVFGVHLWGRPCDVNALEKVTADAGLRLFFDAAHAIGCTS
QGRPVGRFGHAEVFSFHATKVVNAFEGGAIVTDDDDLAHRVRSLANFGFGLHSPSAAGGT
NAKMSEASAAMGLTSLDAFPEVARHNQANYEQYCGELARIPGLSVIDFAPDERHNYQYVI
VEIDPDVTGLHRDLLVDLLRAENVVAQRYFSPACHQLEPYRSRQQFQLPHTERLSARVLA
LPTGSAISREDIRRVCNIVRLAVSRGFELTARWQQQPGPDGQSVVAPG
NT seq 1227 nt   +upstreamnt  +downstreamnt
atgaagcgagatctcggggatctggcactcttcggaggacacgccagcttcctccagcag
atccacgtcgggcgccccaaccggatcgatcgggccaggctgttcgaccggctgtcctgg
gcgctcgacaacgagtggttgaccaacaacgggccgctggcacgggagttcgaggagcgg
gtcgccgacatggtcggggtcggcaactgcgtggcgacgtgcaacgccacggtggccctc
cagctgctcgcgcacgccaccgagctgaccggtgaggtgatcatgccatcgctcaccttc
gccgcgaccgcacacgcggtgcgctggctcgggctggagccggtcttctgcgacatcgac
ccgcgcaccggatgcctcgaccacgtggcggtcgccgcggccatcacgccgcgcacgtcg
gcggtcttcggcgtccacctctggggccgcccctgcgacgtcaacgcgctggagaaggtg
accgccgacgcgggcctgcgcctgttcttcgacgccgcccacgccatcgggtgcacctca
cagggccgcccggtggggcggttcggccacgccgaggtgttcagcttccacgcgacgaag
gtcgtcaacgccttcgagggcggggcgatcgtcaccgacgacgacgacctcgcccaccgc
gtccgctccctggcgaacttcggcttcggcctgcacagccccagcgcggccggcggcacc
aacgcgaagatgagcgaggcgtccgccgccatggggctcacctcgctcgacgcgttcccc
gaggtggcccgccacaaccaggccaactacgagcagtactgcggtgagctggcccggatt
cccggcctcagcgtgatcgacttcgcccccgacgagcggcacaactaccagtacgtgatc
gtcgagatcgacccggacgtcaccgggttgcaccgcgacctgctcgtcgacctgctccgg
gccgagaacgtcgtggcgcagcgctacttctcgccggcctgtcaccaattggagccctac
cggtcccggcagcagttccagctgccgcacaccgagcggctctcggcgcgcgtcctggcg
ctgccgaccggctccgccatctcccgggaagacatccgcagggtgtgcaacatcgtgcgg
ttggcggtctcccggggattcgaattgaccgctcggtggcagcagcagcccgggcccgac
ggacagagcgtggtggcacccggttga

DBGET integrated database retrieval system