KEGG   Micromonospora carbonacea: HXZ27_14340
Entry
HXZ27_14340       CDS       T06722                                 

Definition
(GenBank) NTP transferase domain-containing protein
  KO
K20427  valienol-1-phosphate guanylyltransferase [EC:2.7.7.91]
Organism
mcab  Micromonospora carbonacea
Pathway
mcab00525  Acarbose and validamycin biosynthesis
mcab01100  Metabolic pathways
mcab01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mcab00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00525 Acarbose and validamycin biosynthesis
    HXZ27_14340
Enzymes [BR:mcab01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.91  valienol-1-phosphate guanylyltransferase
     HXZ27_14340
SSDB
Motif
Pfam: NTP_transferase NTP_transf_3
Other DBs
NCBI-ProteinID: QLD25244
LinkDB
Position
3469890..3471005
AA seq 371 aa
MNGVRAVLLAGGRGERMGPLGAGRLKPLIPFGGTSRLIDFSLRNACDSGLDEVLLLSQYE
ERMLMDDLHRVWNRTPGFRAHFGPYDEAYRRAAPGTLPAALPERTWPAERGTADALISKE
RWVFGGAPRDVLVLHADHVYRFDYRGMLREHRASKAALTVAYQRIERRFVRLFGMVEFDD
AGHLTAFVEKPAEPTSDLVFAAFCLFDARILRRYLEQLAGTAWQHDISRDVIPAMLAGGE
LIRGHRVPGYWEDIGTVDRYHLAHRSLLARPPSIPLADLPATVRPEVARRMVDEAPGIRR
SLVPADLVNHGEITHSVVYPGARVGAGAVVHDSVLLPGATVAAGARIDGAIVLEDGAVAQ
CAADAAAEAHR
NT seq 1116 nt   +upstreamnt  +downstreamnt
atgaacggcgtacgcgcggtgctgctggccggcggccggggagaacggatgggcccgttg
ggcgccggccggctcaagccgctgatcccgttcggcgggacgagccggctgatcgacttc
agcctgcgcaacgcctgcgactccggcctcgacgaggtgctgctgctgtcgcagtacgag
gaacgcatgctgatggacgacctgcaccgggtctggaaccgcacgccggggttccgcgcc
cacttcgggccctacgacgaggcgtaccgccgcgccgcgcccggcaccctcccggccgcc
ctgccggaacggacctggcccgccgagcggggcaccgcggacgccctgatcagcaaggaa
cgctgggtcttcggcggcgcgccccgcgacgtcctggtgctgcacgccgaccacgtgtac
cgcttcgactaccggggcatgctgcgcgagcaccgggcgtcgaaggccgcgctgacggtc
gcgtaccagcggatcgaacgccgcttcgtgcgcctgttcggcatggtcgagttcgacgac
gccggccacctcaccgcgttcgtcgagaagcccgccgagcccacgagcgacctggtgttc
gcggcgttctgcctgttcgacgcccggatcctgcgccgctacctggagcagctcgccggc
accgcctggcagcacgacatcagccgcgacgtgatccccgccatgctggccggcggggag
ctcatccgcggccaccgggtgccgggctactgggaggacatcggcaccgtcgaccgctac
cacctggcgcaccgctcgctgctggcgcggccgccgtcgatccccctcgccgacctgccc
gccaccgtgcggccggaggtcgcgcggcggatggtcgacgaggcgccggggatccgtcgt
tcgctcgtcccggccgacctggtcaaccacggcgagatcacgcacagcgtcgtctacccc
ggcgcccgcgtgggcgcgggcgcggtggtgcacgacagcgtgctgctgccgggggcgacg
gtggcggccggggcccggatcgacggggcgatcgtcctggaggacggcgccgtcgcgcag
tgcgccgccgatgccgccgccgaggcccaccgatga

DBGET integrated database retrieval system