KEGG   Micromonospora carbonacea: HXZ27_24530
Entry
HXZ27_24530       CDS       T06722                                 

Definition
(GenBank) isoprenyl transferase
  KO
K21273  trans,polycis-polyprenyl diphosphate synthase [EC:2.5.1.88]
Organism
mcab  Micromonospora carbonacea
Pathway
mcab00900  Terpenoid backbone biosynthesis
mcab01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mcab00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    HXZ27_24530
Enzymes [BR:mcab01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.88  trans,polycis-polyprenyl diphosphate synthase [(2Z,6E)-farnesyl diphosphate specific]
     HXZ27_24530
SSDB
Motif
Pfam: Prenyltransf
Other DBs
NCBI-ProteinID: QLD28796
LinkDB
Position
complement(5923178..5923981)
AA seq 267 aa
MRAGRREPVPPTPHPSGARPPALPGDALPKHVAIVMDGNGRWAKERGLPRTKGHEQGEHS
LFDTVEGAIELGIPYLSAYAFSTENWRRSPDEVRFLMGFNRDVIRRRRDQLVDLGVRVVW
SGRAGRLWKSVISELQTAEEMSRGNSTLTLQFCVNYGGQAEIADAAAAIARDVAAGRLDP
GKVTEKTVAKYLYHPEVPDVDLFLRPSGEERISNFLLWQTAYAELVFLDTLWPDFDRRHL
WYACELYAQRDRRFGGALPNPVAPPQP
NT seq 804 nt   +upstreamnt  +downstreamnt
atgagggccggccggcgcgagccggtgccgccgactccgcacccgtcgggcgcccggccc
ccggcgctgccgggcgacgcgctgccgaagcacgtcgcgatcgtcatggacggcaacggc
cggtgggccaaggagcgggggctgccccgcacgaagggccacgagcagggcgagcacagc
ctcttcgacaccgtcgagggcgcgatcgagctgggcatcccctacctgtcggcgtacgcg
ttctccaccgagaactggcggcgttccccggacgaggtccggttcctgatgggcttcaac
cgggacgtcatccgtcgccgccgcgaccagctcgtcgacctgggcgtgcgggtcgtctgg
tcgggccgggccggtcggctgtggaagagcgtcatctccgagttgcagaccgccgaggag
atgtcgcgcggcaactcgacgctgacgctgcagttctgcgtcaactacggcgggcaggcc
gagatcgccgacgcggccgccgcgatcgcccgcgacgtggcggcgggccggctcgacccg
ggcaaggtcaccgagaagaccgtggcgaagtacctctaccacccggaggtccccgacgtg
gacctcttcctccgcccgtccggcgaggagcggatctccaacttcctgctctggcagacc
gcgtacgcggagctggtgttcctcgacaccctctggcccgacttcgaccgccggcacctg
tggtacgcgtgcgagctgtacgcccagcgggaccgccggttcggcggggcgctgcccaac
ccggtcgccccgccacagccctga

DBGET integrated database retrieval system