KEGG   Macrococcus canis: MCCS_02030Help
Entry
MCCS_02030        CDS       T04838                                 

Gene name
ahpF
Definition
(GenBank) NADH dehydrogenase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
mcak  Macrococcus canis
Brite
KEGG Orthology (KO) [BR:mcak00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    MCCS_02030 (ahpF)
Enzymes [BR:mcak01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     MCCS_02030 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 HI0933_like FAD_oxidored FAD_binding_2 DAO K_oxygenase AlaDh_PNT_C Thi4 FMO-like FAD_binding_3 Glutaredoxin NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: ARQ05874
UniProt: A0A1W7A8P7
LinkDB All DBs
Position
184006..185529
Genome map
AA seq 507 aa AA seqDB search
MLDNNLKQQLGQYLELLEGDVVLTASKGDDKASQDMMELLNEIGAMSDKISIQEASLKRT
PSFTVGRPEEEARITFAGVPLGHEFTSLVLALLQVSGRAPKLDESVINQIKKIDKPLNFE
TFISLTCTKCPDVVQALNIMSVINPNITHTMIDGAVFREESKDIMAVPSIFLDGEEFGSG
KMTVEEIINQVGGGADASEFDAREPFDVLVIGGGPASAAASIYAARKGLRTGIVAERIGG
QVNDTAAIENFISVKETTGPEFAQNLADHIKSYDIDVMNAVRVESIEKIDDMVHVTLENG
GKLSSKTLIISTGAKWRNMNVPGEAEYKNKGVAYCPHCDGPLFEGKRVAVVGGGNSGVEA
AIDLAGIVEHVTLLEFGEALRADKVLQERLASLENTEIIKSAATKELTGADKLQALTYVD
RTTNEERTVELEGVFVQIGLVPSTEFVGDLVERNNRGEIIVDRNGATNVPGIFAAGDCTD
QTYKQIIISMGAGATAALSAFDYLIRN
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgctagataataatttaaagcagcagcttggtcaatatcttgaattgcttgaaggtgat
gttgtacttacagcaagtaaaggagacgataaagcgtctcaagacatgatggaattactt
aatgaaattggtgcgatgtcagataaaatttcgattcaagaggcatctttaaagagaaca
ccgagctttacagtaggacgtcctgaagaggaggcacgtattacgtttgcaggtgtaccg
ttaggtcatgaatttacatcattggtactagctttactgcaagtgagtggcagagctcca
aaacttgatgaatctgtgattaatcagattaaaaagatcgataaaccgttaaactttgaa
acgtttataagtttaacttgtacaaaatgccctgacgtagttcaggcattgaatataatg
tcagtgattaatccgaatattacgcatacgatgattgatggcgcagtatttagagaagaa
tcaaaagatattatggcagtgccaagtattttcttagatggtgaagaatttggcagcggt
aagatgacggttgaagagattattaatcaagttggcggcggtgccgatgcatcagagttt
gatgctagagaaccatttgatgtacttgtgattggtggcggtcctgcaagtgcagcggct
tctatatatgctgcacgtaaaggtttaagaactggtatcgttgcagaacgtattggcggt
caagtaaatgatactgccgcaattgaaaactttatctctgtaaaagagactacaggtcct
gaatttgcacagaacttagctgatcatattaagagctatgatatcgatgtgatgaatgca
gtgcgtgtagagtcaattgagaaaattgatgacatggttcatgttacccttgaaaatggc
ggaaagctatcaagtaaaacattgattattagtacaggtgcgaaatggcgtaatatgaac
gtgccaggtgaagctgaatataaaaataaaggtgtagcttactgtccacactgtgatggt
cctttatttgaaggtaaacgtgttgcggttgttggtggaggaaactctggtgtagaagca
gcgatagatttagctggtattgttgaacatgttactttacttgaatttggtgaagcatta
agagcagataaagtgttacaagaacgtcttgcttcattagaaaacacagaaattatcaaa
tctgcagctacgaaagagttaacaggtgcagataaacttcaagctttaacttatgtagat
cgtacaacaaacgaagagcgtacagttgaattagaaggagtcttcgtccaaattggttta
gtgccaagcactgaatttgttggagatttagtagagcgcaacaaccgtggtgagatcatc
gtggatcgtaatggtgctacaaatgttccgggtatatttgcagcaggagactgtacggat
caaacttataaacaaattattatttctatgggtgcaggtgcaacagcagcattaagtgca
tttgactatttaattagaaattaa

DBGET integrated database retrieval system