KEGG   Macrococcus canis: MCCS_04810Help
Entry
MCCS_04810        CDS       T04838                                 

Definition
(GenBank) Alpha-amylase precursor
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
mcak  Macrococcus canis
Pathway
mcak00500  Starch and sucrose metabolism
mcak01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mcak00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    MCCS_04810
Enzymes [BR:mcak01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     MCCS_04810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Glyco_hydro_70 DUF1939 hDGE_amylase GHL6
Motif
Other DBs
NCBI-ProteinID: ARQ06144
UniProt: A0A1W7A9H6
LinkDB All DBs
Position
complement(427354..428805)
Genome map
AA seq 483 aa AA seqDB search
MTKNYTMMQYFEWHANGDGAHWKRLKEDAPKLKEKGIDAIWLPPACKADHVMNTGYSIYD
LYDLGEFDQKGQVRTKYGTKEELLDAIKACHDNDIKVYADIVLNHKAGADEAETIKVVEV
DPNDRNHVISEPFEIDAYTKFEFPGRNNKYSDFKWNHTHFNGTDYDHKTGRSGIFKILGE
NKDWNEFVDDEKGNFDYLMFTNIDYKHPDVREHTIEWGKWLIDTLGIDGMRMDAVKHIES
YFIKDFSDAMREHAGEDFYFLGEYWNADLGKNQKFLEEADYNTDLFDVKLHFNFKAASEA
GSAYDLRTLFDDTIVAEHPELAVTFVDNHDSQPGEALESFVKDWFKQSAYALILLREDGY
PCIFYGDYYGIGGDQPVEGKQLAIDPLLYIRQNKAYGEQDDYFDHPNVIGFVRRGNGNKT
GCAVIINSSEEEAEKQMFVGKERAGEVWYDYTNTREDKITIDEEGNGLFKVNPGSVSVYC
EEE
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaaaattatacgatgatgcaatatttcgaatggcatgctaatggagatggtgcg
cactggaaacgtctgaaagaagatgcaccgaagctaaaagaaaaaggaatcgatgccata
tggctaccacctgcatgcaaagcagaccacgtaatgaatacaggttatagcatctatgac
ctatatgatcttggggaattcgaccaaaaaggacaagtgcgaacaaaatacgggacgaaa
gaagaactgttagacgcaattaaagcttgtcatgataacgatataaaagtttatgcagat
attgtcctcaatcacaaagctggcgcagatgaagcagaaacaatcaaagtcgtagaagtt
gatccaaatgatcgtaaccatgttatctcagaacctttcgaaatcgatgcctacacaaaa
tttgaattcccgggtcgtaacaacaaatacagcgattttaaatggaaccatacacacttt
aacggtactgactacgatcacaaaacaggacgcagcggtatctttaaaatattaggcgaa
aataaagactggaatgaattcgtagatgatgagaaaggcaactttgattacttaatgttt
acaaatatcgattataaacatccagatgtaagggagcatacaatcgaatggggaaaatgg
ctcatcgatacattaggaatagacggcatgcgtatggatgctgtgaaacatatcgaaagc
tactttattaaagatttcagtgacgcgatgcgtgaacatgccggtgaagacttctatttc
ctgggtgagtattggaacgcagaccttggtaagaatcagaagtttcttgaagaggcggat
tacaacactgatctattcgatgttaaactgcacttcaacttcaaagccgcttctgaagca
ggcagtgcctatgatttacgtacactattcgatgatacgatcgttgcagagcaccctgaa
cttgcagtcacatttgttgataaccatgactctcagccaggtgaagcattggagtccttc
gttaaagactggttcaaacaaagcgcttatgcattaatattattacgtgaagatggctat
ccatgtatattctatggtgattattatggtatcggcggagatcagccagtcgagggaaaa
cagcttgcaatcgatccattactttatattagacaaaataaagcatatggagaacaagac
gattacttcgatcatccgaatgtcatcggatttgtcagacgcggaaatggcaataagaca
ggttgtgctgtaattatcaattcaagtgaagaagaagcagaaaaacagatgtttgtcggt
aaagaacgcgctggtgaagtctggtatgattacacaaatacgagagaagataaaatcact
attgatgaagaaggaaacggtctcttcaaagttaacccaggaagcgtatcagtttactgc
gaagaagaataa

DBGET integrated database retrieval system