KEGG   Macrococcus canis: MCCS_07800Help
Entry
MCCS_07800        CDS       T04838                                 

Gene name
yjlD
Definition
(GenBank) NADH dehydrogenase-like protein YjlD
  KO
K03885  NADH dehydrogenase [EC:1.6.99.3]
Organism
mcak  Macrococcus canis
Pathway
mcak00190  Oxidative phosphorylation
Brite
KEGG Orthology (KO) [BR:mcak00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    MCCS_07800 (yjlD)
Enzymes [BR:mcak01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.99  With unknown physiological acceptors
    1.6.99.3  NADH dehydrogenase
     MCCS_07800 (yjlD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox K_oxygenase NAD_binding_8 NAD_binding_9 Pyr_redox_3 Lycopene_cycl DUF3866
Motif
Other DBs
NCBI-ProteinID: ARQ06428
UniProt: A0A1W7AA33
LinkDB All DBs
Position
complement(719053..720117)
Genome map
AA seq 354 aa AA seqDB search
MKNLVLLGGGYGNMRIMQRLLPNTLPDEYNITLIDKIPFHGLKTEFYALAAGTESDKDVR
VEFPKDKRLNIVFGEITHIDLDKQIISLGENHVDYDELVIGLGCEDKYHNVPGAEEYTYS
IQTMTKARKTYQAIADLPSGSCVGIVGAGLSGIELASELRESRKDLKIRLFDRGERILPA
FPEKLSAYVKKWFDKNDVEVIPNSNVVKVEPGKLYNNDVTYEVDICVWTAGIQPVELVRT
LPVELGDGNRVKVNQYHQIPEHNNVYVVGDCAALPHAPSAQLAELQAEQIVDVMKHVWQN
KPLPETMPELKVQGFMGSLGDKEGFAFLMEKTVTGRLARLMKSGVLWLYKYHNG
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatttagtgttacttggtgggggatacggtaatatgcgtattatgcaacgtctt
ttgcctaatacattaccggatgagtacaatattacattaattgataagataccatttcac
ggacttaagacggagttctatgcgctcgcagctggaacggaatcggataaagatgtacgc
gtggaatttccaaaggacaaacgactgaatatcgtcttcggggaaatcacacatatcgac
ttggataagcagattatttctctcggtgaaaatcatgtagattacgatgaactcgttatc
ggactcggctgtgaagataaatatcataacgtaccgggtgctgaagaatacacgtacagt
attcagacgatgacgaaagcacgcaaaacatatcaggcgattgctgacttaccaagcgga
agctgcgttggtattgtcggtgcaggtttaagtggtatcgaactagcgagtgaattacgt
gaatcaagaaaggatctgaagattcgactctttgaccgcggagaacgcatacttcctgca
ttcccagagaaattaagtgcatacgtaaagaaatggttcgataagaacgacgttgaagtg
ataccaaactctaacgttgttaaagtagaacctggaaagctatataacaacgatgtcaca
tatgaagtcgatatatgtgtatggacagcaggaatacaacctgtcgaactcgttcgcaca
ttaccagtggaacttggggacgggaatcgtgtcaaagtgaatcaatatcatcaaatacct
gaacataataatgtgtacgttgtaggtgactgtgccgcattaccacatgcaccaagtgca
caactcgctgaactgcaggcagaacagatcgtagatgttatgaaacacgtatggcagaat
aagccgcttcctgaaacgatgccagaacttaaagttcaaggatttatgggctctctagga
gataaagaaggatttgccttcttaatggaaaaaaccgttaccggcagactcgcacgactt
atgaaatccggcgtcctgtggctgtataaatatcataatggataa

DBGET integrated database retrieval system