KEGG   Macrococcus canis: MCCS_17790Help
Entry
MCCS_17790        CDS       T04838                                 

Gene name
pfkA
Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
mcak  Macrococcus canis
Pathway
mcak00010  Glycolysis / Gluconeogenesis
mcak00030  Pentose phosphate pathway
mcak00051  Fructose and mannose metabolism
mcak00052  Galactose metabolism
mcak00680  Methane metabolism
mcak01100  Metabolic pathways
mcak01110  Biosynthesis of secondary metabolites
mcak01120  Microbial metabolism in diverse environments
mcak01130  Biosynthesis of antibiotics
mcak01200  Carbon metabolism
mcak01230  Biosynthesis of amino acids
mcak03018  RNA degradation
Module
mcak_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
mcak_M00345  Formaldehyde assimilation, ribulose monophosphate pathway
Brite
KEGG Orthology (KO) [BR:mcak00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MCCS_17790 (pfkA)
   00030 Pentose phosphate pathway
    MCCS_17790 (pfkA)
   00051 Fructose and mannose metabolism
    MCCS_17790 (pfkA)
   00052 Galactose metabolism
    MCCS_17790 (pfkA)
  09102 Energy metabolism
   00680 Methane metabolism
    MCCS_17790 (pfkA)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    MCCS_17790 (pfkA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatase and associated proteins [BR:mcak01009]
    MCCS_17790 (pfkA)
  09182 Protein families: genetic information processing
   03019 Messenger RNA Biogenesis [BR:mcak03019]
    MCCS_17790 (pfkA)
Enzymes [BR:mcak01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     MCCS_17790 (pfkA)
Protein phosphatases and associated proteins [BR:mcak01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     MCCS_17790 (pfkA)
Messenger RNA biogenesis [BR:mcak03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     MCCS_17790 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase
Motif
Other DBs
NCBI-ProteinID: ARQ07410
UniProt: A0A1W7AE53
LinkDB All DBs
Position
complement(1635600..1636559)
Genome map
AA seq 319 aa AA seqDB search
MKKIAVLTSGGDAPGMNAAVRAVVRKAMFHGIEVYGVYQGYQGLINNNIKKMERGTVGDK
IQRGGTFLQSARCPEFKDPEVRKKAIANLNNLGIEGLVVIGGDGSYRGAQRLNEEGIKTI
GIPGTIDNDINGTDFTIGFDTALNTIVEAIDKIRDTASSHERTFIVEVMGRDAGDLALWS
GLAGGAETVLCPEHRKDVKVIADKIQQGIERGKKHSIIVVAEGVMTGEECGQELKKYINV
DTRISVLGHMQRGGSPSGMDRVLASRLGGYAVELLMNDETGLAVGIQNNSLSKTKFEDIF
TSVHHLDEKMYDLSNELSI
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaagaagatagctgtattaacaagtggtggcgatgcaccaggaatgaatgctgcagta
cgtgctgtcgtgcgtaaagcaatgtttcatggaatagaagtttatggtgtatatcaagga
tatcaaggtttaatcaataataatatcaagaagatggaacgtggtactgtaggggataag
atacagcgtggcggaacttttctgcaatcagcacgttgtccagaatttaaagacccagaa
gtacgtaagaaggcaattgccaatttaaataatcttggtatcgaaggtctagtggttata
ggaggcgatggaagttatcgcggtgcccaaagactgaacgaagaaggtattaagacaatc
ggtattccaggtacgattgataatgatattaatggaacagactttacgatagggtttgat
acggctttaaatacgattgttgaagcaattgataagataagagatacagcatcaagccat
gaacgtacattcatcgtagaagttatgggtagagatgccggagacttggcattatggtct
ggacttgctggaggtgctgagactgtactatgtccggagcaccgtaaggacgttaaggtt
attgccgataaaattcagcaagggatcgaacgtggtaagaaacattcaatcatcgtagtt
gctgaaggtgttatgactggtgaagaatgtggtcaggaactaaagaaatatatcaatgtt
gatacgcgtatttctgtacttggacatatgcagcgcggaggttcaccttcaggtatggat
agagtacttgcaagccgtctaggtggttatgctgtagaattactgatgaatgacgagact
ggtctggcagtaggtattcagaataacagtttatctaagacgaaatttgaagatatcttc
acttctgtacatcatctagatgagaagatgtatgacttatctaacgaattatctatataa

DBGET integrated database retrieval system