KEGG   Mus caroli (Ryukyu mouse): 110283623
Entry
110283623         CDS       T05910                                 

Gene name
Fn1
Definition
(RefSeq) fibronectin isoform X1
  KO
K05717  fibronectin 1
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04151  PI3K-Akt signaling pathway
mcal04510  Focal adhesion
mcal04512  ECM-receptor interaction
mcal04810  Regulation of actin cytoskeleton
mcal04933  AGE-RAGE signaling pathway in diabetic complications
mcal05100  Bacterial invasion of epithelial cells
mcal05135  Yersinia infection
mcal05146  Amoebiasis
mcal05165  Human papillomavirus infection
mcal05200  Pathways in cancer
mcal05205  Proteoglycans in cancer
mcal05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    110283623 (Fn1)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    110283623 (Fn1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110283623 (Fn1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    110283623 (Fn1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110283623 (Fn1)
   05205 Proteoglycans in cancer
    110283623 (Fn1)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    110283623 (Fn1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    110283623 (Fn1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    110283623 (Fn1)
   05100 Bacterial invasion of epithelial cells
    110283623 (Fn1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    110283623 (Fn1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    110283623 (Fn1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mcal04131]
    110283623 (Fn1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcal04147]
    110283623 (Fn1)
   00536 Glycosaminoglycan binding proteins [BR:mcal00536]
    110283623 (Fn1)
   04990 Domain-containing proteins not elsewhere classified [BR:mcal04990]
    110283623 (Fn1)
Membrane trafficking [BR:mcal04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   ER-Golgi intermediate compartment (ERGIC) proteins
    110283623 (Fn1)
Exosome [BR:mcal04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   110283623 (Fn1)
Glycosaminoglycan binding proteins [BR:mcal00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   110283623 (Fn1)
Domain-containing proteins not elsewhere classified [BR:mcal04990]
 Fibronectin (FN) domain-containing proteins
  Fibronectin type I domain-containing proteins
   110283623 (Fn1)
SSDB
Motif
Pfam: fn3 fn1 fn2 Pur_ac_phosph_N DUF2369 DUF4959 DUF4912
Other DBs
NCBI-GeneID: 110283623
NCBI-ProteinID: XP_021005078
Ensembl: MGP_CAROLIEiJ_G0014239
UniProt: A0A6P5NZ65
LinkDB
Position
1
AA seq 2296 aa
MLRGPGPGRLLLLAVLCLGTSVRCTEAGKSKRQAQQIVQPQSPVAVSQSKPGCFDNGKHY
QINQQWERTYLGNALVCTCYGGSRGFNCESKPEPEETCFDKYTGNTYKVGDTYERPKDSM
IWDCTCIGAGRGRISCTIANRCHEGGQSYKIGDKWRRPHETGGYMLECLCLGNGKGEWTC
KPIAEKCFDHAAGTSYVVGETWEKPYQGWMMVDCTCLGEGNGRITCTSRNRCNDQDTRTS
YRIGDTWSKKDNRGNLLQCVCTGNGRGEWKCERHALQSASAGSGSFTDVRTAIYQPQTHP
QPAPYGHCVTDSGVVYSVGMQWLKSQGNKQMLCTCLGNGVSCQETAVTQTYGGNSNGEPC
VLPFTYNGRTFYSCTTEGRQDGHLWCSTTSNYEQDQKYSFCTDHAVLVQTRGGNSNGALC
HFPFLYNNRNYTDCTSEGRRDNMKWCGTTQNYDADQKFGFCPMAAHEEICTTNEGVMYRI
GDQWDKQHDLGHMMRCTCVGNGRGEWACIPYSQLRDQCIVDDITYNVNDTFHKRHEEGHM
LNCTCFGQGRGRWKCDPIDQCQDSETRTFYQIGDSWEKFVHGVRYQCYCYGRGIGEWHCQ
PLQTYPGTTGPVQVIITETPSQPNSHPIQWNAPEPSHITKYILRWRPKTSGGRWKEATIP
GHLNSYTIKGLTPGVIYEGQLISIQQYGHREVTRFDFTTSASTPVTSNTVTGETAPYSPV
VATSESVTEITASSFVVSWVSASDTVSGFRVEYELSEEGDEPQYLDLPSTATSVNIPDLL
PGRKYIVNVYQISEEGKQSLILSTSQTTAPDAPPDPTVDQVDDTSIVVRWSRPQAPITGY
RIVYSPSVEGSSTELNLPETANSVTLSDLQPGVQYNITIYAVEENQESTPVFIQQETTGT
PRSDNVPPPTDLQFVELTDVKVTIMWTPPDSVVSGYRVEVLPVSLPGEHGQRLPVNRNTF
AEITGLSPGVTYLFKVFAVHQGRESNPLTAQQTTKLDAPTNLQFVNETDRTVLVTWTPPR
ARIAGYRLTAGLTRGGQPKQYNVGPLASKYPLRNLQPGSEYTVTLVAVKGNQQSPKATGV
FTTLQPLRSIPPYNTEVTETTIVITWTPAPRIGFKLGVRPSQGGEAPREVTSDSGSIVVS
GLTPGVEYTYTIQVLRDGQERDAPIVNRVVTPLSPPTNLHLEANPDTGVLTVSWERSTTP
DITGYRITTTPTNGQQGTSLEEVVHADQSSCTFENLNPGLEYNVSVYTVKDDKESAPISD
TVVPAVPPPTDLRFTNIGPDTMRVTWAPPPSIELTNLLVRYSPVKNEEDVAELSISPSDN
AVVLTNLLPGTEYLVSVSSVYEQHESIPLRGRQKTGLDSPTGFDSSDITANSFTVHWVAP
RAPITGYIIRHHPEHSVGRPRQDRVPPSRNSITLTNLNPGTEYVVSIIAVNGREESPPLI
GQQATVSDIPRDLEVIASTPTSLLISWEPPAVSVRYYRITYGETGGNSPVQEFTVPGSKS
TATINNIKPGADYTITLYAVTGRGDSPASSKPVSINYKTEIDKPSQMQVTDVQDNSISVR
WLPSTSPVTGYRVTTTPKNGLGPSKTKTASPDQTEMTIEGLQPTVEYVVSVYAQNRNGES
QPLVQTAVTTIPAPTNLKFSQVTPTSFTAQWIAPNVQLTGYRVRVNPKEKTGPMKEINLS
PDSSSVIVSGLMVATKYEVSVYALKDTLTSRPAQGVITTLENVSPPRRARVTDATETTIT
ISWRTKTETITGFQVDAIPANGQTPVQRTISPDVRSYTITGLQPGTDYKIHLYTLNDNAR
SSPVIIDASTAIDAPSNLRFLTTTPNSLLVSWQAPRARITGYIIKYEKPGSPPREVVPRP
RPGITEATITGLEPGTEYTIYVIALKNNQKSEPLIGRKKTDELPQLVTLPHPNLHGPEIL
DVPSTVQKTPFITNPGYDTENGIQLPGTTHQQPSVGQQMIFEEHGFRRTTPPTAATPVRL
RPRPYLPNVDEEVQIGHVPRGDVDYHLYPHVPGLNPNASTGQEALSQTTISWTPFQESSE
YIISCQPVGTDEEPLQFQVPGTSTSATLTGLTRGVTYNIIVEALQNQRRHKVREEVVTVG
NAVSEGLNQPTDDSCFDPYTVSHYAIGEEWERLSDAGFKLTCQCLGFGSGHFRCDSSKWC
HDNGVNYKIGEKWDRQGENGQRMSCTCLGNGKGEFKCDPHEATCYDDGKTYHVGEQWQKE
YLGAICSCTCFGGQRGWRCDNCRRPGAAEPSPDGTTGHTYNQYTQRYHQRTNTNVNCPIE
CFMPLDVQADRDDSRE
NT seq 6891 nt   +upstreamnt  +downstreamnt
atgctcaggggtccgggacccgggcggctgctgctgctggcagtcctgtgcctggggacc
tcggtgcgctgcaccgaagccgggaagagcaagaggcaggctcagcaaatcgtgcagcct
caatccccggtggctgtcagtcagagcaagcctggctgttttgacaatgggaagcactat
cagataaatcagcagtgggaacggacctacctaggcaacgccctggtttgtacctgctat
ggaggaagccggggttttaactgcgagagcaagcctgagcctgaagagacttgctttgac
aaatatactgggaacacttacaaagtgggtgacacttatgagcgccctaaagattccatg
atctgggactgtacctgcatcggggctgggagaggcaggatcagctgtaccattgcaaat
cgctgccatgaagggggtcagtcctacaagattggcgacaagtggaggaggccacatgag
actggtggctacatgttagagtgtctgtgtctgggaaatggaaaaggggaatggacctgc
aaacctatagctgagaagtgttttgatcatgctgctgggacgtcctacgtcgtgggggag
acctgggaaaagccctaccaaggctggatgatggtggactgtacctgtctaggcgaaggc
aatggacgcatcacctgtacctccagaaacagatgcaacgatcaggacacccggacatcc
tatagaattggagacacgtggagcaagaaggacaaccgaggaaacctgcttcagtgcgtc
tgcacaggcaatggcagaggggagtggaagtgtgagcgacatgctctacaaagtgcttca
gccggatctggctccttcactgatgtccgaacagctatttaccaaccgcagactcacccc
cagcccgctccctacggccactgtgtcaccgacagtggtgtggtgtattctgtgggaatg
cagtggctgaagtcgcaaggaaacaagcaaatgctgtgcacgtgcctgggcaatggagtc
agctgccaggagacagccgtgacccagacttatggtggcaattcaaatggggagccctgt
gtcctcccgttcacctacaacggtaggaccttctattcctgcaccaccgaagggcggcaa
gacggacatctgtggtgtagcacaacttctaattacgaacaagaccagaagtattccttc
tgcacagaccatgcggttttggttcagactcgaggcggaaattccaatggtgctctgtgc
cacttccccttcctgtacaacaaccggaattacaccgactgtacttctgagggtcgcagg
gacaacatgaaatggtgtggcacaacccagaactacgatgccgatcaaaagtttggattc
tgcccaatggctgcccatgaggagatctgcacaaccaatgaaggggtcatgtatcgcatt
ggggaccagtgggataagcagcatgacctgggccacatgatgaggtgcacgtgtgtaggg
aacggtcgtggagaatgggcctgcatcccctactcccagctccgagatcagtgcattgtc
gatgacattacttacaatgtgaacgacacgttccacaagcgtcacgaggagggacatatg
ctgaactgtacctgctttggtcagggccggggcagatggaagtgtgaccccattgaccag
tgccaagattcagagacccggactttttaccagattggtgactcctgggagaagtttgtg
catggtgtccgataccagtgttactgctacggccgtggcatcggggagtggcactgtcaa
cctctgcagacctacccaggcacaactggacctgtccaagtaattatcacggagaccccc
agccagcccaattcccaccccatccagtggaatgccccagagccttcacacatcaccaag
tacattctcagatggagacctaaaacctctgggggtcgctggaaggaagctaccattcct
ggccaccttaactcctataccatcaaaggcctgaccccaggtgtgatctatgagggacag
ctcatcagcatccagcagtatgggcacagagaagtgactcgctttgacttcaccaccagc
gccagcacccctgtgaccagcaacacggtgaccggagagactgcgccctattctcctgtt
gtggccacttctgaatctgtaactgaaatcacagccagcagctttgtggtctcatgggtc
tcagcctccgacaccgtgtcaggattccgggtggagtatgagctgagcgaggagggagat
gaaccacagtaccttgatctcccaagcacggccacttctgtgaacattcctgacctgctc
ccgggcagaaagtacattgtcaatgtctatcagatatctgaggagggaaaacagagcttg
atcctgtctacctcgcagactacagcacctgacgctcctccagaccctaccgtggaccag
gttgatgatacttccattgttgttcggtggagtagaccccaggcacctatcacagggtat
agaattgtctattcgccttcagtagaaggcagtagcacagagctcaacctccctgaaacg
gccaactccgtcaccctcagcgacctgcagcccggtgttcagtacaacatcactatctat
gctgtggaggagaatcaggagagcacacccgttttcatccaacaggagaccactggcacc
ccaagatctgataacgttccccctccgacggacctacagtttgtggaactgacggatgtg
aaagtcaccatcatgtggacccctcctgatagtgtggtgtctggataccgtgtggaggtc
ctgcctgtcagcctgcctggggaacatgggcagaggctgcctgtcaacagaaataccttt
gctgaaatcactgggctgtcccctggggtcacgtacctcttcaaagtctttgctgtgcac
cagggcagggaaagcaatcctctgacagcacaacagaccaccaaactcgacgctcccacc
aacctccagtttgtcaatgaaactgacagaacagttctggtaacgtggactccacctcga
gcccgtatagcaggctaccgactgaccgcgggcctgacccgaggaggccagcctaagcag
tacaatgtgggacccttggcctccaagtatcccctgagaaatctgcagcctgggtctgag
tacaccgtgaccttggtggctgtgaaagggaaccagcagagtcccaaagccaccggagtc
tttactaccctgcagcctctgcgctccattcccccttacaacaccgaggtgacagagacc
acaattgtgatcacctggacccccgctccaaggattggcttcaagctgggtgtacgaccg
agccagggaggtgaggcaccccgagaagtgacttcagactcagggagcattgttgtgtct
ggcttgactccaggcgtggaatacacttacaccatccaagtcctgcgagatggccaggag
agagatgcaccgattgtcaacagagtagtgacaccgctgtctccaccaaccaacttgcac
ctggaggcaaaccctgacactggagtgcttactgtctcctgggagaggagcactacccca
gatatcactggctacagaataacgacgacccccacgaacgggcagcaggggacctctctg
gaagaagtggtccatgctgatcagagttcctgcacttttgagaacctgaatcctggcctg
gagtacaatgtcagtgtttacactgtcaaagatgacaaggaaagtgcccctatctctgat
accgttgtcccagctgtccctcctcccacggatctgcgattcaccaatattggtccagac
actatgcgggtcacttgggccccacctccgtccatcgagctgaccaacctcttggtgcgc
tactcacccgtgaagaatgaagaggacgttgcagagttatccatttcaccttcagacaat
gctgtggtcctaacaaatctcctgcctgggactgaatacttagtcagtgtctccagtgtc
tacgaacaacacgagagcatccctctccggggaaggcagaaaacaggtctcgattcccca
actggttttgattcttctgatatcaccgccaactcattcactgttcactgggtggctcct
cgggcccccatcaccggctacatcatccgccatcaccctgagcattctgtgggaagaccc
aggcaggatcgagtgccgccctcgcggaattccatcaccctcaccaaccttaatccgggc
accgagtacgttgtcagcatcattgctgttaatggcagagaggagagcccaccactgatt
ggccagcaagccacagtttctgatattccgagagatctggaggtcattgcctccaccccc
accagcctgctaatcagttgggaaccccctgccgtctctgtgcgctattacaggatcacc
tacggagagacaggaggaaatagccctgtccaggagttcactgtgcccggaagcaagtcc
acagccaccatcaacaacattaaaccaggagcagactacaccatcaccctgtatgctgtc
actggccgtggggacagtccagccagcagcaagccagtttccatcaattataaaacagaa
attgacaagccgtcccagatgcaggtgacagatgtccaggacaacagcatcagtgtcagg
tggctgccttcaacttctcctgtgacgggctacagagtgaccaccactcccaaaaatggc
ctaggaccatcaaaaactaaaactgccagtccagatcaaacagagatgaccattgaaggt
ttgcaacccaccgtggagtacgtggttagtgtttatgctcagaaccggaacggagaaagc
cagcccctggttcaaactgcagtgaccaccattcctgcgcccaccaacctgaagttcagt
caggtgacacccaccagctttactgcccagtggatagcacccaatgttcagctcactggc
taccgggtgcgggtgaacccgaaagagaagacaggaccaatgaaagaaatcaacctttct
ccagacagctcatcggtgattgtgtcaggactcatggtggccaccaaatacgaagtcagt
gtctatgctctcaaggacacattgacaagcagaccagctcagggtgtcatcacaacactg
gagaatgttagccctccaagaagggcccgtgtgacggacgctacagagaccaccatcact
attagctggagaacgaagacagagacaatcactggcttccaagtcgatgccatcccagct
aatggccagaccccagtccagaggaccatcagcccggatgtcagaagctacaccattaca
ggtttacagccaggcactgactacaagatccacctgtacactctgaacgacaatgcccgg
agctcgcccgtgatcatcgatgcctccaccgccatcgatgcaccatccaacctgcggttc
ctgaccaccacacccaactccttgctggtgtcatggcaggcgccccgtgccaggattact
ggctacattatcaagtatgagaagcctggatcccctcccagagaagtggtccctcggccc
cgccctggtatcacggaggccaccattactggtctggagccaggaaccgagtacaccatc
tatgtcattgccctgaagaacaatcagaagagtgagcccctgattgggaggaaaaagaca
gacgagcttccccaactggttacccttccacaccccaatcttcatggaccagagatcttg
gatgttccctccacagttcaaaagacccccttcatcaccaaccctgggtatgacaccgaa
aatggtattcagcttcctggcacaacccaccagcaacccagtgttgggcaacaaatgatc
tttgaggaacatggctttaggcggacaacgccacccactgcggccacccccgtcaggctt
aggccaagaccatacctgccgaatgtagatgaggaggtccaaatcggtcatgttcccagg
ggagacgtagactaccacctctatcctcatgttccggggctcaatccaaatgcctctaca
ggacaggaagctctctctcagacaaccatctcttggacgccgttccaggagagttctgag
tacatcatttcatgccaacctgttggcaccgacgaagagcccttacagttccaagttcct
ggaacttctaccagtgcaactctgactggccttaccagaggggtcacctacaacatcata
gtggaggcactgcagaaccagaggaggcacaaggttcgggaagaggttgtgactgtgggc
aacgctgtcagcgaaggcctgaaccagcctacagatgactcatgctttgacccttacacg
gtttcccattacgccattggagaggaatgggagcggctgtctgatgctggctttaagctc
acatgccagtgcttgggctttggcagtggtcatttcagatgcgattcatctaaatggtgc
catgacaacggtgtcaactacaagatcggagagaagtgggatcgccagggagaaaatggc
cagcggatgagctgcacatgcctcgggaatggaaagggagaattcaagtgtgatccccat
gaagcaacgtgctatgacgacgggaagacctaccacgtaggagaacagtggcagaaagaa
tatctcggagccatttgctcctgcacatgtttcggaggccagcggggttggcgctgtgac
aactgccgcagaccgggggctgctgaacccagtcctgatggcaccaccggccacacctac
aaccagtatacacagagataccatcagagaacaaatactaacgtaaattgccccattgaa
tgcttcatgccgttagatgtgcaagctgacagagatgattcccgagagtaa

KEGG   Mus caroli (Ryukyu mouse): 110285111
Entry
110285111         CDS       T05910                                 

Gene name
Lama3
Definition
(RefSeq) laminin subunit alpha-3
  KO
K06240  laminin, alpha 3/5
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04151  PI3K-Akt signaling pathway
mcal04510  Focal adhesion
mcal04512  ECM-receptor interaction
mcal05145  Toxoplasmosis
mcal05146  Amoebiasis
mcal05165  Human papillomavirus infection
mcal05200  Pathways in cancer
mcal05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    110285111 (Lama3)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    110285111 (Lama3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110285111 (Lama3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110285111 (Lama3)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    110285111 (Lama3)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    110285111 (Lama3)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    110285111 (Lama3)
   05145 Toxoplasmosis
    110285111 (Lama3)
SSDB
Motif
Pfam: Laminin_EGF Laminin_I Laminin_G_2 Laminin_N Laminin_G_1 Laminin_II Laminin_B Laminin_G_3
Other DBs
NCBI-GeneID: 110285111
NCBI-ProteinID: XP_021006778
Ensembl: MGP_CAROLIEiJ_G0022005
LinkDB
Position
18
AA seq 3332 aa
MAVALGRAPRSLPLLLTLLLLLLLRMSPSWSVVAQDHPMSSRSLHPPYFNLAQAARIWAT
ATCGERDPEVSRPRPELFCKLVGGPTAQGSGHTIQGQFCDYCNSEDSRKAHPAIHAIDGS
ERWWQSPPLSSGTQYNQVNLTLDLGQLFHVAYILIKFANSPRPDLWVLERSVDFGNTYSP
WQYFAHSRRDCVEQFGQEANMAITQDDQMLCVTEYSRIVPLENGEIVVSLINGRPGAKKF
AFSDTLREFTKATNIRLRFLRTNTLLGHLISKAERDPTVTRRYYYSIKDISVGGRCVCNG
HAEACSADNPEKQFRCECQHHTCGDTCNRCCAGYNQRLWRPAGQEQHNECEACNCHGHAV
DCYYDPDVEHQQASLNSKGVYAGGGVCINCQHNTAGVNCEKCAKGYFRPHGVPVNAQHGC
IPCSCDPERADDCDQGSGHCHCKPNFSGDYCEMCADGYYNFPFCLRIPVFPNYTPSLEDP
VAGNIKGCDCNLEGVLPEICDDRGRCLCRPGVEGPQCDSCRSGSYSFPICQACQCSMIGS
YPVPCDPGNGQCDCLPGITGRQCDRCLSGAYDFPYCQGSGSVCHPAGTLDSSLVSRGHGY
PGKLPEINIRHNFLILGNLTMVLNSRCIECQCHEAGTLSGIGECGQEDGDCSCKAHVTGD
ACDTCEDGFFSLEKSNYFGCQGCQCDIGGALTTMCSGPSGVCQCREHVEGKQCQRPENNY
YFPDLHHMKYEVEDGTGPNGRDLRFGFDPLVFPEFSWRGYAPMTSVQNEVRVRLSVRQSS
LSLFRIVLRYISPGMEAISGRITLYSSRGESDALQSRKITFPPSKEPAFVTVPGNGFADP
FSITPGTWIACIQVEGVLLDYLVLLPRDYYEAFTLQVPVTEPCAHTGSPQDNCLLYQHLP
LTAFSCTLACEARHFLLDGELRPLAMRQPTPTHPAMVDLSGREVELQLRLRVPQVGHYVV
MLEYATEVDQLFVVDMNLKSSGSALAGQVNIYSCKYSIPCRSVVIDSRRRTAVHELLADT
DIQLKAHMAHFLLYHICIIPAEEFSIEYLRPQVHCIATYGQHANPSASCVSLAHETPPTA
LILDATSRGLFSALPHEPSSPADGVTLKAPQSQVTLRGLIPHLGRHVFVIHFYQAEHPGF
PTEVIVNGGRQWSGSFLASFCPHLLGCRDQVISGGQVELDISEAEVAVTVKVPDGKSLTL
VRVLVVPAENYDYQILHKTTVDKSSEFISSCGGDSFYIDPQAASGFCKNSARSLVAFYHN
GAIPCECDPAGTAGHHCSPEGGQCPCRPNVIGRQCTRCATGYYGFPYCKPCNCGRRLCEE
VTGKCLCPPHTVRPQCEVCEMNSFNFHPVAGCDVCNCSRKGTIEAAISECDRDSGQCRCK
PRVTGQQCDKCAPGFYQFPECVPCSCNRDGTEPSVCDPETGACMCKENVEGPQCQLCREG
SFYLDPTNPKGCTKCFCFGVNTDCQSSHKQRAKFVDMKGWRLETADGVDVPVSFNPGSNS
MVADLQELPPSVHSASWVAPPSYLGDKVSSYGGYLTYHAKSFGLPGDMVLLGKQPDVQLT
GQHMSLIHKEPSDPRPDRLHHGRVQVIEGNFRHEGNSAPVSREELMTVLSRLERLHIRGL
HFTETQRLTLGEVGLEEASDTGSGPRAHLVEMCACPPDYTGDSCQGCRPGYYRDDKSLPV
GRCVPCNCNGHSNRCQDGSGICINCQHNTAGEHCERCQAGHYGNAIHGSCRVCPCPHTNS
FATGCAVEGGAVRCACKPGYTGTQCERCAPGYFGNPQKFGGSCQPCNCNSNGQLGPCDPL
TGDCVNQEPKDGSPAEECDDCDSCVMTLLNDLASMGEELRLVKSKLQGLSVSTGALEQIR
HMETQAKDLRNQLLGFRSATSSHGSKMDGLEKELSHLNREFETLQEKAQVNSRKAQTLYN
NIDQTIQSAKELDLKIKNIAQNVHILLKQMARPGGEGTDLPVGDWSRELAEAQRMMRDLR
SRDFKKHLQEAEAEKMEAQLLLHRIRTWLESHQVENNGLLKNIRDSLNDYEDKLQDLRSI
LQEAAAQAKQATGINHENEGVLGAIQRQMKEMDSLKNDFTKYLATADSSLLQTNNLLQQM
DKSQKEYESLAAALNGARQELSDRVRELSRSGGKAPLVVEAEKHAQSLQELAKQLEEIKR
NTSGDELVRCAVDAATAYENILNAIRAAEDAASKATSASMSAFQTVIKEDLPKRAKTLSS
DSEELLNEAKMTQKRLQQVSTGLNSLQQTLKTVSVQKDLLDANLTVARDDLHGIQRGDIN
SVVSGAKSMVREANGITSEVLDGLNPIQTDLGRIKDSYESARHEDFSKALVDANNSVKKL
TKKLPDLFIKIESINQQLLPLGNISDNVDRIRELIQQARDAANKVAIPMRFNGKSGVEVR
LPNDLEDLKGYTSLSLFLQRPDLRENGGTEDMFVMYLGNKDASKDYIGMAVVDGQLTCVY
NLGDREAEVQIDQVLTESESQEAVMDRVKFQRIYQFAKLNYTKEATSTKPKAPGVYDMES
TSSNTLLNLDPENAIFYVGGYPPGFELPRRLRFPPYKGCIELDDLNENVLSLYNFKTTFN
LNTTEVEPCRRRKEESDKNYFEGTGYARIPTQPNAPFPNFMQTIQTTVDRGLLFFAENQD
NFISLNIEDGNLMVKYKLNSEPPKEKGIRDTINNGRDHMILISIGKSQKRMLINMNKHSI
IIEGEIFDFSTYYLGGIPIAIRERFNISTPAFQGCMKNLKKTSGVVRLNDTVGVTKKCSE
DWKLVRTASFSRGGQMSFTNLDVPSLDRFQLSFGFQTFQPSGTLLNHQTRTSSLLVTLED
GHIALSTRDSSSLIFKSPGTYMDGLLHHVSVISDTSGLRLLIDDQVLRRNQRLSSFSNAQ
QSLSMGGGYFEGCISNVFVQRMSQSPEVLDMASKSTKRDAFLGGCSLNKPPFLMLFKSPK
GFNKARSFNVNQLLQDAPQAARSIEAWQDGKSCLPPLNTKATHRALQFGDSPTSHLLFKL
PQELLKPRLQFSLDIQTTSSRGLVFHTGTRDSFVALYLSEGHVIFALGAGGKKVRLRSKE
RYHDGKWHTVVFELSGRKARLVVDGLRAQEGSLPGNSTISPREQVYLGLSPSRKSKSLPQ
HSFVGCLRNFQLDSKPLDSPSARSGVSPCLGGSLEKGIYFSQGGGHVVLANSVSLGPALT
LTLSIRPRSLTGVLIHIASQSGEHLSVYMEAGKVTTSMNSEAGGTVTSITPKRSLCDGQW
HSVAVSIKQHTLHLELDTDNSYTAGQLSFPPNSTRGSLHIGGVPDKLKMLSLPVWNSFFG
CLKNIQVNHIPVPITEATEVQGSVSLNGCPDH
NT seq 9999 nt   +upstreamnt  +downstreamnt
atggctgtggctctgggcagggcgccgcgatccttaccgctgctgctcactctattgctg
ctgctgttgctgaggatgtcgcccagctggagcgtggtggctcaggaccatcccatgtcc
tcgcgcagcctgcacccgccctacttcaacctggcccaggcggcgagaatctgggctacc
gccacctgcggggagcgggacccagaggtctcaaggccccggcctgagcttttctgcaaa
ttggtgggcggccccactgcacagggcagcggccataccatccagggccagttctgtgac
tactgcaattctgaggattccaggaaggcacatccagccatccatgcaattgatggatcg
gaacggtggtggcaaagcccgcctctctcctccggcacacagtacaatcaagtcaacctc
accttggatctgggtcagctcttccatgtggcttatatcttaatcaaatttgcaaactct
ccccgccctgatctttgggtcctggaaagatctgtcgactttgggaacacctactcacca
tggcagtattttgcacattctagaagagattgtgtagaacagtttgggcaagaagcaaac
atggcaattacccaggacgaccagatgctctgtgtcacggagtattcccgtatcgtgcct
ctggaaaatggcgagattgttgtatccttgataaatggtcgtccaggtgcaaagaagttt
gctttctctgacactctgagggagtttactaaggcaacaaacatccgcttgcgatttctg
agaaccaacaccctcctcgggcatcttatttccaaggcagagcgagaccccactgtcacg
cgccggtattattatagcataaaggatatcagtgttggtgggcggtgtgtttgcaacggc
catgcggaggcgtgcagtgctgacaaccctgaaaagcagttccgatgcgaatgccagcac
catacctgtggagacacgtgtaatcgctgctgtgcaggttacaatcagaggctctggcgg
cctgctggtcaggagcagcacaatgagtgtgaagcctgcaactgccatgggcatgctgtg
gactgctactatgacccagatgtggagcaccagcaggcaagcttgaacagcaaaggtgtc
tacgcaggtggaggggtctgcatcaactgtcagcacaacactgcaggtgtgaactgtgaa
aagtgtgcgaagggttacttccggccccacggagttccggtgaacgctcagcacggatgc
atcccttgcagctgtgacccagaacgcgcagatgactgtgaccagggctcaggccactgc
cattgtaagccaaatttctccggagactactgtgagatgtgtgcagatgggtactataat
ttcccattttgcttgagaattccagtctttcccaactacactccaagtctagaagatcca
gtggctggcaatataaaagggtgtgactgtaacttggaaggtgttcttccagagatatgt
gacgatcgtggcaggtgcctgtgccgccctggggttgagggtccccaatgtgactcctgc
cgctcgggctcctattcatttcccatatgccaagcttgccagtgttcgatgattggatcc
tatccagtgccctgtgaccctgggaatggccagtgtgactgcctgcctggaattactggg
aggcagtgtgacaggtgtctctctggagcttatgactttccctactgccaagggtccggc
agtgtttgccatccagctgggacccttgactccagcctggtaagtaggggtcatggctac
cctggaaaacttcctgaaattaacataagacacaattttcttatactgggcaacctcacc
atggttttaaattcaagatgcatagagtgccagtgccatgaagcagggacactgagtgga
attggagagtgtgggcaggaggacggtgactgtagctgcaaagcccatgtaactggtgat
gcctgtgacacctgtgaagatgggtttttctctttggagaagagcaattactttggctgt
caagggtgtcagtgtgacattggtggagcactcaccaccatgtgtagtgggccctcggga
gtatgccagtgcagagagcacgtggaggggaaacagtgccagaggcctgaaaataactac
tacttcccggatttgcaccacatgaagtatgaggtcgaagacggcactggacctaatgga
agagacctgcggtttggatttgatcccctggtattccctgagtttagctggagaggatat
gctccaatgacctcggtacagaatgaagtaagggtgagattgtctgtgaggcagtccagc
ctctccttgttccgcatcgttctgagatacatcagtcctggaatggaagccatatccggc
cgaatcactctttactcatcgcggggagagtccgatgctttgcaaagcagaaaaatcacc
tttcccccgagtaaagagccagcctttgtcacagtccctgggaatggctttgcagaccca
ttctccatcacacctgggacatggattgcttgcatccaggtggaaggagtccttctggac
tacctggtgctgcttcccagggactactatgaagcattcaccctgcaagtgccggtcaca
gagccatgtgcccacacaggatctccccaggacaactgtttgctttaccagcatttacca
ctgactgccttctcctgtaccctggcttgtgaggccagacacttcctgctggatggagag
ctgagacccttggcaatgaggcagcccacacccacacacccagccatggtggacctcagc
gggagagaggtagaactgcagctacgtctgcgggtcccacaggttggccactatgtggtc
atgctggagtatgccacggaggtggaccagctttttgtggtggacatgaacctgaagagc
tcagggtctgccttggcaggccaggtgaacatatacagctgcaagtacagcatcccgtgc
aggagtgtggtgattgacagccggaggcgcacggctgtacatgagctgttggcagataca
gacattcagctcaaggcgcacatggcccatttccttttgtatcacatttgtattataccg
gctgaagaattctcaattgaatatttgagacctcaagtccactgcattgccacctacggg
cagcatgctaatccaagtgcttcctgtgtctccctggcccatgaaactcctccaacagcc
ttaattttggatgctacaagtaggggccttttctctgctctacctcatgagccttcctct
cctgcagatggagttactctgaaggcaccacagagtcaagtgaccctgagaggactcata
ccacacctgggccgacatgtctttgtcatccatttttatcaagcagagcacccggggttt
cccactgaggtgattgtgaatggaggaagacagtggtcaggttccttccttgcctccttc
tgtccccacttacttggctgccgggaccaggtgatctctggtggccaggtagagttggac
atctctgaagcagaggtagctgtgacagtgaaggttccagatggaaagtccttaacgttg
gtccgggttctagtggtacctgcagagaattacgactaccaaattcttcacaaaacaaca
gtggacaagtcctccgagttcatcagcagttgtggaggagacagcttttatattgatccc
caggcagcctctggattctgtaagaattctgcaaggtccctggtagccttttaccataat
ggtgccataccctgtgagtgcgaccctgctgggactgccggccatcactgtagtcctgag
ggtgggcagtgcccttgccggcccaatgtcatcgggaggcagtgcacccgctgtgcaaca
ggctactatggattcccatactgcaagccttgtaattgtggcagacgcctttgtgaagag
gtgacagggaagtgtctctgcccaccccacacagtcaggcctcagtgtgaggtctgtgag
atgaattccttcaacttccaccctgtggctggctgtgacgtctgcaactgctccaggaag
ggcaccattgaggcggccatctctgagtgtgacagggacagcgggcagtgcaggtgcaag
cctagagtcacagggcagcagtgtgacaagtgtgctcctggcttctaccagttccctgag
tgtgtcccctgcagctgtaacagagatgggactgagcccagcgtatgtgacccagagact
ggggcttgcatgtgcaaggaaaatgtggagggcccccaatgtcaactgtgtcgagaagga
tcattctacctggacccaacaaacccaaagggttgtaccaagtgcttctgtttcggagtg
aatactgactgtcagagttcacataagcaacgagctaagtttgtagacatgaagggctgg
cgtctggagacagcagatggagttgatgtccctgtgtccttcaaccctggcagcaacagc
atggtggcagatctgcaggagctgccaccctcagttcacagtgcatcctgggtggcacct
ccatcctacctaggtgataaggtatcatcatacggcggctacctcacctaccacgccaag
tcctttggcttacctggagacatggttcttctgggaaagcagccagatgtgcagctcact
ggtcaacacatgtccctcatccataaggaacccagcgacccacggccagacaggctgcat
cacggaagagtgcaagtgattgagggaaacttcagacacgaaggcaacagtgccccagtg
tcccgggaggagctgatgactgtgctgtccagactggaaagactccacatccggggcctc
cacttcactgagacacagcggctcaccttgggtgaggtagggctggaggaggcctctgac
acgggaagcggacctagggctcatcttgtggagatgtgtgcctgtccccctgactacaca
ggtgactcatgccagggttgtcgccctggatactatcgggacgacaaaagcttacctgta
ggaaggtgtgttccctgcaattgcaacggacattcaaatagatgccaggatggctccggg
atatgcattaactgtcagcacaacacagctggggagcactgtgagcgttgccaagcaggt
cactatggaaatgccatccacggatcttgtagggtctgcccctgccctcataccaacagt
tttgccaccggctgtgctgtggagggcggagctgtgaggtgtgcctgcaaacccggatac
acaggaacacagtgtgagaggtgtgcaccaggatattttgggaacccccagaaatttgga
ggtagctgccagccatgcaattgtaacagcaatggccagttaggtccttgtgacccccta
actggagactgtgtaaaccaagaacccaaagatggcagccctgcagaagaatgtgatgac
tgcgacagctgtgtgatgacgctcttaaatgacttggcctccatgggtgaggaactccgc
ctggtgaagtcaaagctgcaggggctgagtgtgagcacgggtgctctggaacagatccgg
cacatggagacgcaggccaaggacctgaggaaccagctgcttggcttccgttctgccacc
tcaagtcatgggtccaaaatggatggcctggaaaaagaactgagtcatttgaaccgggaa
tttgaaactctgcaagaaaaggcacaggtcaattccagaaaagcacaaacattatataac
aacattgatcagacaatccaaagcgccaaagaattggacctgaagattaaaaacatcgct
cagaatgtgcacattctcctgaagcagatggctaggccaggtggagaaggcacggacttg
ccagtgggcgactggtccagggagctggccgaagctcaacgcatgatgcgagacctgcga
agccgagactttaaaaagcacctccaagaagcagaggccgagaaaatggaagcccagctc
ttactgcaccggatcaggacctggctggaatcccaccaggtggagaacaacggactgcta
aagaatattcgggactccttaaatgattatgaagacaaacttcaggacttgcgttccatc
ctccaggaggcagctgcccaggcaaagcaggccactggcatcaaccatgaaaatgagggg
gttctcggagccatccagagacaaatgaaagaaatggattccctgaagaatgacttcacc
aagtacctggccacagcagactcttccctgctgcagaccaacaatctactgcagcagatg
gacaaaagccagaaggaatatgaaagcttagctgctgctttaaatggagcaagacaggaa
ctgagtgacagagtgcgagaactgtccagatcgggtggcaaagcaccactggtggtggag
gcagagaagcatgcacagtctttacaggagctggcaaagcagctggaagagataaagaga
aacaccagtggggatgagctggtgcgttgtgctgtggacgctgccacggcctatgagaac
atcctcaatgccatcagagcagcagaggatgcagccagcaaggccaccagtgcctccatg
tctgccttccaaacagtgataaaggaagaccttccaaaaagagctaagaccctgagttct
gacagcgaggaactgttaaatgaagccaagatgacacagaaaaggctacagcaagtcagt
acaggtctcaacagcctacagcaaaccctgaagactgtatcagttcagaaggacctgcta
gatgccaacctcactgttgcccgtgatgatcttcatgggatacagagaggtgatatcaac
agtgtggtgagcggtgcaaagagcatggtcagggaagccaacggaataacaagcgaggtt
ctggacgggctcaacccaatccagacagatttgggaaggattaaggacagctatgagagc
gcacggcatgaagacttcagcaaggctctggtcgatgccaataactcagtaaagaaatta
accaagaagttgcctgatctttttatcaagattgaaagtatcaaccaacagttgctgccc
ctggggaacatctctgacaatgtggaccgaatccgagaactcattcagcaggccagagat
gctgcaaacaaggttgcaattcccatgaggttcaatggtaaatctggtgtcgaagtccga
ctgccgaatgacctagaagatttaaaaggatacacatctctgtctttgtttctccaaaga
cctgacttacgagagaatggaggcactgaggatatgtttgtaatgtaccttgggaataag
gatgcctccaaggactacattggcatggcggttgtagatggccagctgacatgtgtgtac
aacctgggggaccgagaggctgaagttcagatagaccaggtcctgacggagagtgagtct
caggaggcagttatggaccgggtgaagttccagagaatatatcaatttgccaagcttaat
tacaccaaagaagccacatctactaaacccaaagcccctggggtctatgacatggagagc
accagtagcaacacactccttaatttggatccagagaatgcgatattttacgtcggtggt
tatccacctggttttgagcttccgcgcagactgcggttccctccatacaaaggctgtatc
gagctagatgacctcaatgaaaacgttctaagcctgtacaatttcaagacaactttcaac
ctcaataccacggaagtagagccttgcaggaggagaaaggaagagtcggacaaaaattac
tttgaaggtacaggctatgctcgcattcctactcaacccaatgctcccttcccaaacttc
atgcagaccatccaaactaccgtggacagaggtttactgttcttcgcagaaaaccaggat
aacttcatatctctgaatatagaagacggcaatctcatggtaaaatacaaactaaattca
gagccacccaaagagaaaggaattcgagacaccatcaacaacgggagagaccacatgatt
ttaatctcaattggaaaatcacaaaagcgaatgctgataaatatgaataaacatagtata
ataattgaaggggaaatatttgatttcagcacatattatttgggaggaattccaattgca
atcagagaaaggtttaacatctcaacgcctgctttccaaggctgcatgaagaatctgaag
aaaaccagtggggttgtcaggttgaatgatacagtgggtgtaaccaaaaagtgctcggaa
gactggaagcttgtgcgaaccgcctcgttctccagaggaggacagatgagttttacaaac
ttggacgtgccctcacttgaccgcttccagctctcctttgggtttcagacctttcaaccc
agcggtacactactaaaccatcagacacggacaagtagcctactggtcaccctggaagat
ggtcatattgcgttgagcaccagggacagcagcagcctgattttcaagtctccagggacc
tacatggatggtttacttcatcatgtatctgtaataagcgacacctcaggcctgcgcctt
ctcatcgatgaccaggttctgagaagaaaccaaaggctctctagcttctctaatgcccag
cagtcgctcagcatgggaggcggttatttcgagggttgtatcagcaatgtttttgtccaa
aggatgtcacagagtccagaagtcctggatatggccagcaagtctactaagagggatgca
ttcctaggaggctgcagtttaaacaagccaccttttcttatgttgtttaaaagtcccaag
ggatttaacaaggcccggagtttcaatgtcaatcagctgttgcaagatgcacctcaggct
gcaaggagcatagaggcttggcaagatgggaagtcctgcctaccacctctgaacaccaag
gccactcacagagccctgcagtttggggacagtcctaccagccacttgctattcaagctt
ccccaggagctgctgaaacccaggttacagttttctttggacatacagacaacttcctcc
agagggctagtgtttcacacaggcaccagggactcctttgtggctctctatctctcagaa
ggccatgtcatctttgccttgggggcaggagggaagaaagtgagactcagaagcaaagag
agataccacgacgggaagtggcacacggtggtgtttgaactgagtggaagaaaggcgcgc
ctggtggtggatggactaagggcccaggaaggcagtttgcctggaaactctaccatcagc
cccagagaacaggtttacctggggttgtcaccatcaagaaagtcaaagagcctcccccag
cacagttttgtggggtgtctgaggaacttccagttggactcaaaacccctggattccccc
tctgcgaggtctggggtatctccctgcttgggtggctctttggagaaaggcatttatttc
tcccaaggaggaggtcacgtggtcctagccaattccgtgtccttggggccagcacttacg
ctcactctcagcattcgcccacgaagtcttactggggtcttgatccacatcgcaagtcaa
tctggagagcacttaagtgtctacatggaggcagggaaggtcacaacctctatgaacagt
gaggcaggtgggaccgtgacatcaattacaccgaagcgatctctgtgtgatggacaatgg
cactcggtggcagtctccattaaacagcacacgctgcatctggaactggatacagacaat
agctacacagctgggcagctttccttcccaccgaacagcacccgagggtcactacacatt
ggaggcgtcccagacaaattgaaaatgctttcactccctgtgtggaactcattttttggc
tgtctgaagaatattcaagtaaaccacatccctgtccccatcacagaagccacagaagtc
caaggttctgtcagcctgaatggctgccctgaccactaa

KEGG   Mus caroli (Ryukyu mouse): 110286219
Entry
110286219         CDS       T05910                                 

Gene name
Col4a5
Definition
(RefSeq) collagen alpha-5(IV) chain isoform X1
  KO
K06237  collagen type IV alpha
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04151  PI3K-Akt signaling pathway
mcal04510  Focal adhesion
mcal04512  ECM-receptor interaction
mcal04926  Relaxin signaling pathway
mcal04933  AGE-RAGE signaling pathway in diabetic complications
mcal04974  Protein digestion and absorption
mcal05146  Amoebiasis
mcal05165  Human papillomavirus infection
mcal05200  Pathways in cancer
mcal05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    110286219 (Col4a5)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    110286219 (Col4a5)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110286219 (Col4a5)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    110286219 (Col4a5)
  09154 Digestive system
   04974 Protein digestion and absorption
    110286219 (Col4a5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110286219 (Col4a5)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    110286219 (Col4a5)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    110286219 (Col4a5)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    110286219 (Col4a5)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    110286219 (Col4a5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcal04147]
    110286219 (Col4a5)
   00536 Glycosaminoglycan binding proteins [BR:mcal00536]
    110286219 (Col4a5)
Exosome [BR:mcal04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   110286219 (Col4a5)
Glycosaminoglycan binding proteins [BR:mcal00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   110286219 (Col4a5)
SSDB
Motif
Pfam: Collagen C4
Other DBs
NCBI-GeneID: 110286219
NCBI-ProteinID: XP_021008354
Ensembl: MGP_CAROLIEiJ_G0033459
LinkDB
Position
X
AA seq 1691 aa
MQVRGVCLAAGWFLLALCLWGQPAEAAACHGCSSGSKCDCSGIKGEKGERGFPGLEGHPG
LPGFPGPEGPPGPRGQKGDNGIPGPPGPKGIRGPPGLPGFPGTPGLPGMPGHDGAPGPQG
IPGCNGTKGERGFPGSPGFPGLQGPPGPPGIPGMKGEPGSIIMSPLPGPKGNQGFPGSPG
IQGPPGPKGISGPSGPPGPPGLMGPPGPPGPPGPKGNMGLNFQGPKGEKGEQGLQGPPGP
PGQISEQKRPIDIEFQKGDQGVPGDRGPPGPPGIPGPPGRPGGVKGEKGEPGEAGKRGKP
GKDGETGQPGIPGLPGDPGYPGEPGRDGEKGQKGDIGPPGPPGLVIPAPGTGVTMGEKGN
IGLPGLPGEKGERGFPGIQGPPGFPGPPGTSVVGPPGPPGYPGERGQKGDEGPPGICIPG
SPGLDGQPGAPGLPGPPGPPGPQLPSRDEICKAGPPGPPGPPGDKGLQGEQGVKGDKGDT
CFNCIGTGISGPPGQPGLPGLPGPPGSLGIPGEKGDKGQAGITGLKGLPGIPGPPGAPGF
PGSKGDPGDVLTLPGMKGDKGELGFPGAPGLPGLPGSPGKDGLPGLPGPKGEPGGITFKG
ERGPPGSPGLPGLPGNMGPTGPVGFGPPGPIGEKGIKGVAGNPGQPGLPGPKGDPGQTIT
QPGKPGLPGSPGRDGEVGLPGDPGLPGQPGLPGIPGSKGEPGIPGTGPPGPPGPKGFPGI
PGPPGAPGAPGRMGPDGPPGSPGSPGPKGEPGFGLPGPPGPPGFPGFKGTPGPKGDRGFP
GPTGPPGRTGLDGLPGPKGDVGPNGQPGPVGPPGLPGIGLQGPPGPPGTPGPIGQPGLHG
IPGEKGDPGPPGFDVPGLPGERGSPGVPGAPGLIGPPGSPGVPGKAGVPGFPGVKGEMGM
MGPPGPPGPLGIPGRSGAPGLKGDDGMQGQPGLPGPAGEKGSKGEPGLPGPPGPMHPDFL
GSKGEKGEPGLPGIPGLSGPKGYQGLPGDPGQPGLSGQPGSPGLPGPKGNPGLPGPPGLT
GPPGPKGNIGDMGFPGPQGVDGPPGPPGFPGQPGSPGLPGQKGSKGEPGVSGIGLPGLPG
PKGEPGLPGYPGNPGIKGSVGETGLPGLPGNPGAKGQPGLPGFPGTPGLPGPKGMNGPPG
NPGFPGEPGPVGAGGRPGPPGPPGEKGKPGQDGIPGPAGQKGEPGQPGFGIPGPPGLPGL
SGQKGDGGSPGLPGNPGLPGSKGEPGFQGFPGMPGPPGPPGSPGQALEGPKGNPGPQGPP
GRPGPPGFQGPPGTEGPRGPPGNGGIKGERGNPGPPGQPGLPGLKGDQGPPGLPGNPGRP
GLNGMKGDPGLPGVPGFPGMKGPIGVPGSTGPDGEPGLTGPPGPPGLPGPSGQSIVIKGD
PGPPGIPGQPGLKGLPGLPGPQGLPGPIGPPGDPGRNGLPGFDGAGGRKGDPGLPGQPGA
RGLDGPPGPDGLQGPPGPPGTTSVAHGFLITRHSQTTDAPQCPRGTVHIYEGFSLLYVQG
NKRAHGQDLGTAGSCLRRFSTMPFMFCNINNVCNFASRNDYSYWLSTPEPMPMNMEPLKG
QSIQPFISRCAVCEAPAVVIAVHSQTIQIPHCPQGWDSLWIGYSFMMHTSAGAEGSGQAL
ASPGSCLEEFRSAPFIECHGRGTCNYYANSYSFWLATVDMSDMFSKPQSETLKAGDLRTR
ISRCQVCMKRT
NT seq 5076 nt   +upstreamnt  +downstreamnt
atgcaagtgcgtggagtgtgcctggctgccggctggttcttactggccctgtgtctgtgg
gggcagcccgcagaggctgcggcctgccatgggtgttcttctggatcaaaatgtgactgc
agtggtataaaaggagaaaagggagaacggggatttccaggtttagaaggtcatccaggt
ttaccaggatttccaggtccagaaggccctccaggacctcggggacaaaagggtgataat
ggaattccagggccaccaggaccaaaaggaatcagaggccctcctggacttcctggattt
ccggggacaccaggtcttcctgggatgccaggccatgatggggctccaggacctcaaggt
atccctggatgcaatggaaccaagggagaacgtggatttccaggcagtccaggctttcct
ggtttacaaggtcctccaggacctcctgggatcccaggtatgaagggggaaccaggcagt
ataatcatgtcaccactgccaggaccaaagggtaatcaaggattcccaggttctcctgga
atacaaggtccacctggtcccaagggtatatcagggccaagtggtcctccaggaccacca
ggtttaatgggacctcctggcccaccaggcccaccaggaccaaaggggaatatgggctta
aatttccagggacccaaaggtgaaaaaggtgaacaaggtcttcagggcccacctggtcca
cctgggcagatcagcgaacagaaaagaccaattgacatagaatttcagaaaggagatcag
ggagtccctggtgatagagggcctcctggacctccaggaatacctggtcctcccggacgt
cctggtggtgtgaaaggtgaaaagggtgagccaggagaggcaggcaaaaggggtaaacca
ggcaaagatggagagactggccaaccaggaatcccaggtttgcctggtgatcctggttac
cctggtgaaccaggaagggatggtgaaaagggccaaaagggtgatattggcccacctgga
cctcctggacttgtaattcctgcacctggaactggtgtgactatgggagaaaaaggaaat
atcgggttacctggtttgcctggagaaaagggagagcgaggatttcctggaatacaaggt
ccacctggctttcctggacctccaggaacatcagtcgtgggtccccccggtcctcctgga
tatcctggtgaaaggggccagaaaggtgatgaaggtccccctggaatttgtattcctgga
tctcctggacttgatggacagcctggggctcctggccttccaggacctcctggtccccct
ggtccccagttgccatccagagatgaaatctgtaaagcaggccctcctgggcccccagga
cctccaggtgataaaggactccaaggagagcaaggagtaaaaggtgacaaaggtgatact
tgcttcaactgtattggaactggcatttcagggcctccaggccaacctggtttaccaggt
ctcccaggtcctccaggatctcttggaatccctggagagaagggtgacaaaggacaagct
gggataactggtctgaaaggattgccaggcatacctggacctccaggtgctccaggcttt
ccagggtctaagggtgaccctggggatgtcctcactcttccaggaatgaagggtgacaaa
ggagagttgggtttccctggagctccagggcttcctggtctacctggtagtcctggaaag
gatggtttgccaggactccctggccccaagggagagcctggtggaattacttttaagggt
gaaagaggtcctcctgggagcccaggtttaccaggtctcccaggaaatatgggacctaca
ggcccagttggttttgggcctccaggccctataggagaaaaaggcataaaaggtgtggca
ggaaatccaggccagccgggattaccaggtcctaaaggagatccaggccagaccataacc
cagccaggaaagcctggtttgccaggtagtccaggcagagatggtgaagtgggtcttcca
ggtgatcctggacttccaggccaaccaggcctgccaggaataccaggtagcaaaggagaa
ccaggtatccctgggactgggcctcctggaccacctggtcctaaaggttttccaggaatt
ccgggacctccaggagctcctggggcccctggaagaatgggtccagatgggcctcctggg
tcaccaggctccccaggaccaaagggagagccaggatttgggttacctgggccacctggg
ccaccaggattcccaggtttcaaaggaacacctggtccaaaaggtgatcgtggtttccca
ggacctacaggtcctccaggacgcactggcttggatgggctacctggaccaaaaggtgat
gttggaccaaatggacaacctggtccagtagggcctccagggctaccaggaattggtctt
cagggaccaccaggaccaccagggactccagggccaataggccaacctggcttacatggg
attccaggagagaagggggacccaggacctcctgggtttgatgttccaggactccctgga
gagagaggtagtccaggggtccctggagcccccggtcttataggacccccaggatcacct
ggtgtccctggaaaagcaggtgtccctggatttccaggtgtcaaaggcgaaatgggtatg
atgggacctccaggcccacctggacctttgggaattcctggcaggagtggtgctcctggt
cttaaaggtgatgatggcatgcaaggtcagccaggtctccctggccctgcaggagaaaag
ggcagtaagggagagcctggccttccaggtcctcctggaccaatgcatccagatttcctg
ggatcgaaaggagaaaagggtgagcctggcttaccaggtattcctggactttcaggacca
aaaggataccagggattacctggagacccagggcaacctggactgagtggacaaccagga
tcaccaggactcccaggtcccaagggtaatcctggtctccctggtccaccaggacttaca
ggacctcctggaccaaaaggaaacattggtgacatgggttttcctggccctcaaggtgta
gatgggccccctggacctcctggatttcctggacaacctggctctcccgggttacctggc
cagaaaggaagtaaaggagagcctggggtttcaggcattggacttccaggtcttcctggc
ccaaagggtgaacctggtctgcctggatatccaggaaacccaggtatcaaaggttctgtg
ggagagactggtcttcctggattaccaggaaaccctggagcaaaaggtcaaccgggcctg
cctggattcccaggaacaccaggacttcctggcccaaaaggtatgaatggtcctcctggt
aaccctggctttcccggagaacctggtcctgtaggtgctggagggcgtcctggaccacca
ggacctcctggtgaaaaaggcaagccaggtcaagatggcattcctgggccagcaggacaa
aagggagaaccaggtcaaccaggctttggaatcccaggacctcctggactcccaggactt
tctggacaaaagggtgatggaggatcacctggacttccaggaaatcctggccttccaggt
tcaaagggtgagccaggctttcagggattccctggtatgccaggtcctccaggtcctcct
ggttctcctggtcaagctttggaaggtcccaaaggaaaccctgggcctcaaggccctcct
gggagaccaggtcctccaggttttcaaggtccaccaggtacagaaggtcctcgtggcccc
cctggaaatggaggtatcaaaggagagaggggaaatccaggcccacctgggcaaccaggc
ttacctggtttgaaaggagatcaaggaccaccaggactcccgggtaaccctggccggcca
ggtcttaatggaatgaaaggagatcctggtctccctggtgttccaggattcccaggaatg
aaaggacccattggagtaccaggctccactggccctgatggggaaccaggtcttactggg
cccccaggtcctcctgggttgcctggtccttcaggacagagtattgtaatcaaaggagat
cctggacctccagggattcctggacaacctggattaaaaggtctaccaggacttccaggc
cctcaaggcctaccaggtccaattggccctccaggagatccaggacgcaatggactccca
ggctttgatggtgcaggagggcgcaaaggagacccaggtctgccaggacagccaggtgcc
cgtggattggatggtcccccaggaccagatggattgcaaggacctccaggaccccctgga
accacctctgttgcccatggattcctcatcacacgtcacagtcaaacaacagatgcacca
caatgcccacggggaacagtgcatatctatgaaggcttttctctcctgtatgtacaagga
aataaaagagcccatggtcaagacttgggtacggctggcagctgccttcgtcgcttcagt
accatgcctttcatgttctgcaacattaacaacgtttgtaactttgcttcaagaaatgac
tattcttactggctttccaccccagagcccatgccaatgaacatggaacccctgaaggga
cagagcatccagccattcattagtcgatgtgcagtgtgtgaggcgccagctgtggtgatc
gctgttcacagccagactattcagattccacactgtcctcaggggtgggactctctgtgg
attggctattccttcatgatgcatacaagtgcaggagcagaaggctctggccaagcccta
gcctctcctggctcctgtttggaagaatttcgttcagctcccttcatcgaatgtcacggg
cgagggacatgcaattactatgccaattcgtacagcttttggctggccactgttgatatg
tcagacatgttcagtaaacctcagtcagaaacactgaaagcaggagacttgaggacacgt
attagccgatgtcaagtatgcatgaagaggacataa

KEGG   Mus caroli (Ryukyu mouse): 110286404
Entry
110286404         CDS       T05910                                 

Definition
(RefSeq) collagen alpha-6(IV) chain-like
  KO
K06237  collagen type IV alpha
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04151  PI3K-Akt signaling pathway
mcal04510  Focal adhesion
mcal04512  ECM-receptor interaction
mcal04926  Relaxin signaling pathway
mcal04933  AGE-RAGE signaling pathway in diabetic complications
mcal04974  Protein digestion and absorption
mcal05146  Amoebiasis
mcal05165  Human papillomavirus infection
mcal05200  Pathways in cancer
mcal05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    110286404
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    110286404
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110286404
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    110286404
  09154 Digestive system
   04974 Protein digestion and absorption
    110286404
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110286404
  09162 Cancer: specific types
   05222 Small cell lung cancer
    110286404
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    110286404
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    110286404
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    110286404
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcal04147]
    110286404
   00536 Glycosaminoglycan binding proteins [BR:mcal00536]
    110286404
Exosome [BR:mcal04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   110286404
Glycosaminoglycan binding proteins [BR:mcal00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   110286404
SSDB
Motif
Pfam: Collagen C4
Other DBs
NCBI-GeneID: 110286404
NCBI-ProteinID: XP_021008421
Ensembl: MGP_CAROLIEiJ_G0033458
LinkDB
Position
X
AA seq 1662 aa
MGLIDTANYIPKDQHSWWEQGHPGPIGTQGPAGPEGFTGPTGLSGLKGERGSPGPLGPYG
SKGDKGPIGIPGFVGISGIPGHPGQPGPRGPPGPDGCNGTQGAVGFPGPDGYPGILGPPG
LPGHKGAKGEPAPFQGSITGMRGDPGLPGLDGIPGPSGSSGSPGDAGPIGPPGLQGPPGP
PGLPGPDGNMGLGFQGEKGVKGDVGLPGPAGPPPSTGELEFMGFPKGKKGSKGEPGPPGF
PGMSGPPGVPEFGSTGEKGERGILGLPGPRGPMGSEGIQGHPGRQGKKGTSGFPGIKGFP
GIKGEKGDIGVRGPDSFTDADGAVISGYPGDPGVLGLPGLRGDEGVQGQRGPSGTPGLPS
LTGLPGALGPQGFPGLKGDQGNSGRTTFGEAGLPGRVGLPGLPGLPGPSGPPSRTFETGH
LSTIEPGFPGLQGEQGPKGHQGLKGVKGDSGFCACEGGAPNIGPHGEPGLPGIQGPIGLQ
GFKGTRGDAGSRGASGPAGTPGLFGPRGQTGLKGKKGEPTVSRGLKMSGDKGDPGPQGTP
GLAGTPGKDGRPGLPGLPGIQGDGGSGFPGERGLPGLPGEKGHDGPTGPPGIGLPGPPGP
RGLPGDKGVDGLPGQQGLRGAQGVTLPCIIPGSYGPSGFPGAPGFPGSKGSRGLPGIPGK
PGTHGSKGGPGSPGLMHLPGLPGFPGARGEKGLPGFPGLPGKDGYPGKAGSPGLPGFKGA
AGDIFGAENGASGEQGLQGLPGDKGFPGDSGLPGPKGLNGKPGMLGPKGERGNPGTSGPP
GQPGPSGSTDPFGIKGTSGFPGAPGLPGISGHPGKKGQRGDIGQPGSTGKRGLPGIKGLP
GPQGSPGFLGSPGLSGVTGLPGIEGQKGEKGSSGPVGFPGFPGLPGLPGADGLKGFSGSF
GKVGQPGQAGTSGEKGDRGDPGPVGISSPRPPMLNLWFKGEKGSRGSAGSDGFPGPRGDK
GEPGIPGLPGPPGATGQTNTIKGLNGRPGSPGSMGRKGLPGLKGSLGIAGFPGMPGKSGS
QGLAGTSGLLGATGIPGLKGDQGQTLGISGSPGPKGQPGELGFKGVKGKDGLVGDRGYPG
NKGDGGKVGITGDPGFPGSPGLQGISGMNGDPGLPGSSGHLGSIGRPGPSGLIGPKGFPG
APGLHGLNGLPGTKGTHGTPGTSITGVPGPAGLPGPKGERGVPGIAIGDPGKQGSRGQKG
DQGSPGLQGPAGTPGAPGISLPSVIAGQPGDPGRPGLDGERGRPGPPGPPGPPGPSSDQG
DPGDSGFPGIPGLQGFKGNQGLPGFSGLSGELGLKGMRGEPGLMGTPGKIGQPGDPGFPG
MKGKAGPRGFSGPQGAPGHAPIAEAMQVPPGSLGQPGIDGIPGLIGDPGTQGSVGLQGSK
GLPGIPGKDGPSGLPGPSGILGDPGLPGLQGPPGFEGAPGNQGPIGQPGMPGHSVRVGYT
LVKHSQSEQVPLCPTGMSRLWVGYSLLFVEGQEKAHNQDLGFAGSCLPRFSTMPFIYCNI
NEVCHYARRNDKSYWLSTTAPIPMMPVGQTQIPQYISRCSVCEAPSQAIAVHSQDITVPQ
CPLGWHSLWIGYSFLMHTAAGAEGGGQSLVSPGSCLEDFRATPFIECSGARGTCHYFANK
YSFWLTTVEERGQFREEPVSETLKTGQLHTRVSRCQVCMKTL
NT seq 4989 nt   +upstreamnt  +downstreamnt
atgggcctgattgacactgcaaattatatcccaaaggaccagcacagctggtgggaacaa
gggcaccctggaccaattggaactcaaggtccagctggtcctgaagggtttactggtcca
actggtttatcaggtttgaaaggagaaagaggctccccaggccctctgggaccatatgga
tcaaaaggagataagggtcccattggaattcctggctttgttggcatcagtgggattccg
ggccaccctggacaaccaggtccaagaggtccacctggcccagacggctgtaatggaact
caaggagctgttggatttccaggccctgatggctaccctgggattttaggaccacctggg
ctgcctggtcacaaaggtgcaaaaggagaacctgctccttttcaaggcagcattacagga
atgaggggggatcctgggctgcctggactagatggaatccctggtccatcaggttcctcc
ggctctcctggagatgcaggacccataggaccaccaggcttacaaggtcccccagggccc
cccggacttcccggtcctgatggaaatatggggttaggtttccaaggagaaaaaggagtc
aagggggatgttggcctccctggccctgcaggaccacctccatctactggggaactagaa
ttcatgggattccccaaaggaaagaaaggttccaagggtgagccaggacctccaggtttc
ccaggaatgagtggccctccaggtgtcccggaatttggatctactggagaaaaaggagaa
agggggatccttggtttgccaggacctaggggtcccatgggttcagaaggaatacaaggt
catccagggagacagggaaagaaggggacttcaggttttcctgggattaaggggttccca
ggaattaagggtgaaaagggagacattggtgtgcgaggcccagacagtttcactgatgca
gatggcgctgtgatctcaggttatcctggagaccctggtgtgctgggccttccaggcctt
agaggagatgaaggcgtccaaggccaacgtggcccttctggaacccctggcctcccatca
ttaacaggtcttccaggtgccctagggcctcagggatttccaggcctgaaaggagaccaa
ggaaactcaggacgtaccacctttggagaagctggcctacctggcagggttggtttacca
ggtttaccaggcctgccaggcccatcaggcccacctagtcgcacatttgagaccggacat
ctgtccaccatagagcctgggttccctggtctccaaggagaacaaggtccaaaaggacat
caaggccttaaaggagtaaaaggagactctggtttttgtgcttgtgaaggtggtgcaccc
aacattggaccacatggggaaccaggcctgcctgggatacaaggtcccattggtctacag
ggttttaaggggactagaggagatgcaggctcaaggggagcgtctggtcctgcagggacg
ccagggctatttggacctagaggtcagactggcctcaaaggaaagaaaggagaaccaact
gtcagtagaggattaaaaatgtcaggggacaaaggtgaccctggtcctcaggggacccca
ggcttggcaggaactccgggcaaggatggaagaccaggtttaccaggcctcccaggcatt
cagggagatggtgggtctggcttcccaggtgaaagagggttaccaggacttcctggtgaa
aaaggccatgatggtccaactggaccaccaggaattgggctgccaggacctcctgggccc
cgtggacttcctggagataaaggagtagatgggttaccagggcaacaaggcctccgtgga
gctcaaggagtcaccttgccttgtatcatccctgggtcatatggtccatcaggatttcct
ggagctcctggattcccaggctctaagggatctcggggcctccctggaattccaggcaag
cctggcactcacggaagcaaaggagggcctggaagtccagggttaatgcatctcccagga
ttgccagggtttcctggagctcgtggggagaagggattgcctgggtttcctgggcttcct
ggaaaagatggctaccctggaaaagctggcagtccagggttaccaggtttcaagggagct
gctggtgacatatttggtgctgaaaatggtgcttcgggggagcaaggcctacagggattg
ccaggggacaaaggatttcctggagactctggccttccaggacccaagggtttgaatggg
aaacctggtatgctaggccccaagggtgagcggggcaaccctggaacatcaggaccacca
ggtcagccaggaccttcagggtctactgacccatttggcatcaaaggcacatctggattc
ccaggagcaccaggccttccaggcatctcagggcaccctggaaagaaaggtcaaagagga
gacataggtcagcctgggtcaactggaaaaagaggtctacctgggataaaaggccttcct
ggtcctcaagggtcacctggcttcctggggagcccaggtttgtcaggcgtcactgggttg
ccaggcatcgaaggccaaaagggtgaaaaggggtcctctgggccagtaggatttcctggg
ttccctggtcttcctggtcttcctggagctgatggattaaagggattttctgggtcattt
ggaaaggtgggacaacctggacaggctggtacttccggagagaaaggagacagaggggat
ccagggccagttggcatatctagtccaagacctccaatgctaaacctttggttcaaagga
gaaaaaggctctcgaggttctgctggatcggatggatttcctgggcccagaggtgacaaa
ggagagcctggcatcccagggttaccaggtccacctggagctactggacaaaccaatacc
atcaaagggctcaatgggaggccaggttcccctggatctatgggaagaaagggattacct
ggcctgaaggggtctctggggattgcaggtttcccaggaatgccaggaaaaagtggttca
caggggctcgctgggacttctggcctcctgggagcaactggtatcccaggtttaaaagga
gatcaaggccaaacacttggcatttctggaagcccaggacccaagggacagcctggagaa
ttaggttttaaaggtgtcaaaggaaaagatggactagttggtgatagaggttacccagga
aacaaaggtgatggtggaaaagttggaattactggagatcctggcttccctggctcccca
ggacttcaagggatttcaggtatgaatggagacccaggcctcccaggttcctctggccat
ctggggtcaattggccgccctggaccctcaggcttaataggacctaaaggattccctgga
gctcctggtttacatggactgaatggacttccaggcaccaaaggcacccatggcactcca
ggaaccagtattactggtgttcctgggccggctggcctgcctggtcccaaaggggaaagg
ggagtgccaggaattgccatcggagatccagggaaacaaggctcaaggggacaaaaaggt
gaccaaggttccccaggtcttcaaggtcctgctggtacccctggagccccaggcatctcc
ttgccctcagtcatagcaggacagcctggtgaccctgggcggccaggcctagatggagaa
cgaggccgcccaggccctccaggtcctccaggtccccctgggccatcctcagatcaaggc
gatcctggagactctggcttccctggaattccaggccttcaagggttcaagggaaaccaa
ggacttccaggtttctctggcctctctggagagctagggctaaaaggcatgagaggggaa
cctggcctcatggggactcctggcaagatcgggcaaccaggagacccaggatttcctggg
atgaaggggaaggcgggaccaagaggcttttccggcccacagggagctccaggacacgca
ccaattgctgaagctatgcaggttcctccaggatctttgggtcagccaggcattgatggt
atcccaggcctcataggagaccctgggactcaaggctctgtgggtctgcaaggttccaaa
ggcctacctggcatccctgggaaggatggccccagtgggctcccaggcccatctggaatc
cttggtgatcctggtctccctggactacaaggacctccaggatttgaaggagctccagga
aatcagggccccattgggcagcctgggatgcctgggcacagtgtcagagtgggctacaca
ctagtaaaacacagtcagtcagaacaggtgccactatgccccactgggatgagccggctc
tgggtgggttacagcttgctcttcgtggaggggcaggagaaagcccataaccaggatctg
ggatttgctggctcctgcctgccccgattcagcaccatgcccttcatatactgcaacatc
aatgaagtgtgccactatgccagacgcaatgataaatcctactggctttccactactgcc
cccattcccatgatgcctgtgggccagacccagattccccagtatatcagccgctgctct
gtatgtgaggcaccctcacaagccattgctgtacacagtcaggacatcaccgtcccacag
tgccctctgggctggcacagcctctggatcggatactccttcctcatgcacactgctgct
ggggctgagggtggaggccagtccctagtctcccctggctcctgtcttgaggacttccgg
gccactcctttcatcgagtgcagcggcgcccgtggtacatgccactactttgccaacaag
tacagtttctggctgacaacggtggaggagagagggcagtttcgggaagagcccgtgtct
gagacgctgaaaactgggcagcttcacaccagggtgagccgctgccaggtgtgtatgaaa
accctgtag

KEGG   Mus caroli (Ryukyu mouse): 110289599
Entry
110289599         CDS       T05910                                 

Gene name
Col4a3
Definition
(RefSeq) collagen alpha-3(IV) chain
  KO
K06237  collagen type IV alpha
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04151  PI3K-Akt signaling pathway
mcal04510  Focal adhesion
mcal04512  ECM-receptor interaction
mcal04926  Relaxin signaling pathway
mcal04933  AGE-RAGE signaling pathway in diabetic complications
mcal04974  Protein digestion and absorption
mcal05146  Amoebiasis
mcal05165  Human papillomavirus infection
mcal05200  Pathways in cancer
mcal05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    110289599 (Col4a3)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    110289599 (Col4a3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110289599 (Col4a3)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    110289599 (Col4a3)
  09154 Digestive system
   04974 Protein digestion and absorption
    110289599 (Col4a3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110289599 (Col4a3)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    110289599 (Col4a3)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    110289599 (Col4a3)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    110289599 (Col4a3)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    110289599 (Col4a3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcal04147]
    110289599 (Col4a3)
   00536 Glycosaminoglycan binding proteins [BR:mcal00536]
    110289599 (Col4a3)
Exosome [BR:mcal04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   110289599 (Col4a3)
Glycosaminoglycan binding proteins [BR:mcal00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   110289599 (Col4a3)
SSDB
Motif
Pfam: Collagen C4
Other DBs
NCBI-GeneID: 110289599
NCBI-ProteinID: XP_021011544
Ensembl: MGP_CAROLIEiJ_G0014328
UniProt: A0A6P5PBL3
LinkDB
Position
1
AA seq 1669 aa
MHSKSAPRFLVLLLLILLLLLAAPPVASKGCVCKGKGQCLCAGTKGEKGEKGFPGSPGFP
GQKGFPGPEGLPGPQGPKGSPGLPGLTGPKGIRGITGLPGFAGPPGLPGLPGHPGPHGLA
GLPGCNGSKGEQGFPGFPGTPGYAGLPGPDGLKGQKGEPAQGEDRGFNGKGDPGPPGVPG
FQGFPGLPGFPGPAGPPGPPGFFGLPGAMGPRGPKGHMGDRVIGQKGERGMKGLTGPPGP
PGTVTFTLTYAYNKSDFKGEKGDEGERGEPGPPGPSGPPGDSYGSEKGAPGEPGPRGKPG
KDGAPGFPGTEGAKGNRGFPGLRGEAGIKGRKGDIGPPGFPGPTEYYDAYLEKGEKGMPG
LPGPKGARGPQGPSGPPGVPGSPGLTRPGLRGSTGWPGLKGSKGERGPPGKDTVGPPGPL
GCPGSPGPPGPPGPPGCPGDIVFKCSPGEHGMPGDRGPPGAPGLDGPKGEPGSPCTECHC
FPGPPGVPGFPGLDGIKGIPGERGAPGLKGNPGSPGSAGLPGFAGFPGDQGHPGLKGDKG
DTPLPWGQVGDPGDPGLRGLPGRKGSDGIPGGPGAKGPPGPQGEPALSGRKGDQGPPGPP
GFPGPPGPAGPAGPPGYGPQGEPGPKGAQGVPGVLGPPGEAGLKGEPSTSTPVLGPPGPP
GPPGQAGPRGLPGLPGPVGKCDPGLPGPDGEPGIPEAGCPGPPGPKGNQGFPGTKGSPGC
PGEMGKPGRPGEPGIPGAKGEPSVGKPGEPGKPGFPGERGNAGENGDIGLPGLPGLPGTP
GRGGLDGPPGDPGQPGPPGAKGSPGRCIPGPRGTQGLPGLNGLKGQPGRRGDTGPKGDPG
IPGMDRSGVPGDPGPPGTPGCPGEMGPPGQKGYPGAPGFPGPPGEKGEIGMMGYPGTTGP
PGLPGKPGSQGQRGSLGIPGLKGERGRPGAKGERGEKGKPGPSQATLLKGDKGEPGLKGF
VGNPGEKGNRGNPGLPGPKGLEGLPGLPGPPGPRGDTGSTGNPGRPGPHGMPGSMGSMGV
PGPKGRKGTSGLPGLAGRPGLPGIHGPQGDKGEPGYSEGARPGPPGPKGDPGLPGDKGKK
GERGLPGPPGRSGPAGPDGAPGSPGSPGHPGKPGPAGDLGLKGQKGFPGPPGSTGPPGPP
GLPGLPGPMGMRGDQGRDGIPGPPGEKGETGLLGAYPGPKGSPGVPGAKGDRGVPGLSGL
PGRKGVMGNVGPQGPPGTAGLPGSPGLPGAIVPGPKGDRGLPGLRGNPGEPGPPGPPGPI
GKGIKGDKGFMGPPGPKGLPGTVGDMGPPGFPGAPGIPGLPGVRGDPGFPGFPGIKGEKG
NPGFLGPIGHPGPVGPKGPPGPRGKPGTLKVISLPGSPGPPGVPGHPGMKGDPGPLGPPG
IPGPCGPRGKPGKDGKPGTPGPAGAEGNKGSKGQQGPPGLDGLPGLKGNPGDRGMPATGT
RMRGFIFTRHSQTTAIPSCPEGTQPLYSGFSLLFVQGNERAHGQDLGTLGSCLQRFTTMP
FLFCNINNVCNFASRNDYSYWLSTPALMPMDMAPISGRALEPYISRCTVCEGPAMAIAVH
SQTTAIPPCPQDWVSLWKGFSFIMFTSAGSEGAGQALASPGSCLEEFRASPFIECHGRGT
CNYYSNSYSFWLASLNPERMFRKPIPSTVKAGDLEKIISRCQVCMKKRH
NT seq 5010 nt   +upstreamnt  +downstreamnt
atgcactccaagtctgctccaaggttcctggtgctcctgctgcttatcctgctgctgctc
ctggctgccccgcctgtggctagcaagggctgtgtctgcaaaggcaaaggacaatgcctc
tgcgcggggaccaaaggggagaagggggagaaaggctttcctggttcccctggatttcct
ggccagaaaggatttccaggtcctgaaggcttgcctggaccacagggacccaagggctcc
ccaggacttccgggactcactggccccaaaggcatcaggggaataactggattaccagga
tttgcaggtcctcctggacttccaggcctcccaggccaccctgggcctcatgggctggct
ggtttaccaggatgcaacggttctaagggtgaacaaggattcccaggctttccgggcaca
ccaggctatgcagggctcccaggtcctgatggcttgaaaggacaaaagggtgagcctgct
caaggagaagacaggggattcaatggaaaaggtgaccctgggcctccaggcgttccaggc
ttccagggttttccgggactcccaggttttccagggcctgccggtccaccaggacctccg
ggattttttggtttaccaggagcaatgggacccagaggacccaaaggccacatgggcgat
agagtgataggacaaaaaggagaaaggggtatgaaaggattaacaggacctcctgggcca
ccaggaacagtgacttttacactcacttatgcgtacaacaaatcggacttcaagggagag
aaaggagatgagggagagaggggtgaacccggacctcctggaccctcggggccacctgga
gactcctatggatcagaaaagggtgcgcctggagagcctggtcctcggggcaaacctgga
aaagatggtgcccctggcttccctggcactgagggagccaaaggcaacaggggctttcct
gggttgaggggtgaagctggcattaagggaaggaaaggagacattggccccccaggattt
cctggtccaacagaatattatgacgcatacctggaaaagggagagaaagggatgccagga
cttcctgggcccaaaggagcccgtggcccacagggtccaagtggtccccctggagtccct
ggaagtcctggactgacaaggcctggcctcagaggatccactggatggccaggcttgaaa
gggagtaaaggagagagaggaccccctggaaaagacactgtgggacctcctggacccctg
ggatgtcctggctcaccaggtccaccaggcccgccaggacctccaggatgtccaggtgac
attgtttttaaatgttcccctggtgagcatggaatgccaggtgatagaggacctccagga
gctccaggacttgatggacccaaaggagaaccaggcagtccatgcaccgagtgtcactgc
ttcccagggccccctggagtcccaggatttccaggattagatggtatcaaaggaatccca
ggagaacgaggtgcgcctggtctgaagggaaacccagggtccccaggaagtgcaggtctc
ccaggatttgcaggattcccaggtgaccaagggcatccaggacttaaaggggacaaaggg
gacacacctctaccctgggggcaagtgggtgatccaggtgatcctggactcagaggcctg
cccgggagaaagggctctgatggaattcctggaggtccaggagcgaaaggaccaccagga
cctcagggcgaaccggccctgagtggaaggaaaggggaccagggacctccaggacctcct
ggattccctggacccccaggacctgcaggaccagctggaccaccaggctatggaccccaa
ggagagccaggtccaaagggagcccaaggagtccccggcgtcctgggaccacctggagaa
gccggtcttaaaggagaacccagtacatcaactccagttctaggtcccccaggccctcca
gggccccctggtcaggctggccccagaggtctacctggtttgcctggaccggtgggaaaa
tgtgatcctggtcttcctggacctgatggtgaaccaggaattccagaagctggatgccca
gggcctccaggacctaagggaaatcaaggtttcccagggacaaaaggatcacctggttgt
cctggggaaatgggaaagcctggccgtcctggagagccaggcatcccaggagccaaggga
gaaccatccgtaggcaagcctggggaaccagggaaaccaggctttccaggagaaagaggc
aatgctggagaaaatggagatattggactccctgggcttccaggcctccctggaactcca
ggaagaggcgggcttgacgggcctccaggagacccaggacagcctggaccacctggagca
aaaggatccccaggaagatgtataccaggacccaggggcacccaaggacttccaggcttg
aatggattgaaagggcaaccaggtcgaagaggtgataccgggccaaagggagaccctggc
atcccaggcatggacaggtctggggtccccggagatcctggaccaccaggaacaccaggt
tgtcctggtgagatgggaccacctggacaaaaaggttatccgggagctccaggattccca
gggccaccaggcgagaaaggagagattggaatgatgggctatcctggaaccactggccct
ccgggacttcctgggaaaccaggctcacaggggcagcgaggtagcctcggaatcccagga
ctgaaaggggaaagaggacgcccaggagccaaaggagaacgaggagagaaaggcaagcct
gggccttctcaagcaacactcttaaagggagacaaaggagagcctggacttaaaggattt
gttgggaatccaggtgagaaaggaaacagaggcaacccagggttaccaggtccaaaaggc
ctcgagggattgcctgggctaccgggccctccaggccctagaggagatacggggagcaca
ggaaatcctggaagaccaggaccacacggcatgccaggaagcatggggagcatgggggtg
ccaggccctaaagggagaaaaggaacttcagggcttccaggtctagctggaagaccaggc
ctgccagggatccatggtccccaaggagataagggggagccgggttattcagaaggtgca
aggccaggaccaccaggaccaaagggcgatccaggattgccaggtgacaaaggaaagaaa
ggagaaagaggcctacctgggccacctggacgatcgggacctgccggacctgatggagcc
cctgggagtcctgggagtcctggtcacccaggaaaaccaggtcctgctggtgatttgggt
ctgaaaggacagaaaggcttcccaggccctccaggaagcactggccctccaggccctcca
ggactcccaggacttcctgggccaatgggtatgagaggtgaccaaggacgtgatggaatt
cctggtcctccaggagaaaaaggagaaacaggcttgctgggggcctacccaggcccaaaa
gggagccctggtgtaccaggtgccaaaggagacaggggagttccaggcttgtctggcctt
cccggcaggaagggggttatggggaatgttggaccccaaggacccccaggcaccgctgga
ctcccagggtcaccaggtctacctggggcaattgtccctggccccaaaggagacagaggt
cttcctggcttaagaggaaatccaggtgagccaggtccccctggacctccaggacctatc
ggaaaaggcataaaaggtgacaaaggatttatgggtccacctggccccaaaggtctgcct
ggaactgtaggggacatgggcccaccaggtttcccgggagcaccaggtatccccggtctt
cccggtgtcagaggtgatccaggattccccggatttccaggcataaaaggagagaagggt
aaccccggatttcttgggccaattggacatccaggaccagttgggccaaaaggaccacca
ggtccacgtggaaaacctggcactcttaaggtcatctctcttccgggaagcccagggcca
cctggtgtacctggacatccaggaatgaaaggagaccctggacccctgggaccaccagga
atcccaggaccctgtgggccaagaggtaaaccaggcaaggatgggaaaccaggaactcca
ggaccagctggtgcagagggcaacaagggctcgaaaggacagcaaggcccacctggtctg
gatggattgccaggtttaaagggaaatcctggtgacaggggaatgccggccactggtaca
agaatgcgaggcttcatcttcacccgacacagtcaaaccacggccattccttcatgccct
gaaggaacacagccactctatagtggcttttctcttctttttgtacaaggaaacgaacgt
gcacatggacaagaccttggtactctgggcagctgcctgcagcgattcaccacaatgcca
ttcttattctgtaacatcaataatgtatgtaactttgcatcacgaaatgactattcatac
tggctgtcaacaccagctctgatgccaatggacatggctccaattagtggcagagctctc
gaaccctatattagcagatgcactgtctgtgaaggtccagcaatggccatagctgttcac
agtcaaactactgctatccctccatgtccccaggactgggtttctctctggaaaggcttt
tctttcattatgttcacaagtgcaggctctgagggtgctggacaagcacttgcctcgcct
ggctcctgcctggaagaattccgagccagtccatttatagagtgccatggacgagggaca
tgtaactactactcaaactcctacagtttctggctggcttcgctgaacccagaaagaatg
ttcagaaaacctattccatcaactgtgaaagctggagacttagagaaaatcataagccgc
tgtcaggtgtgcatgaagaaaagacattga

KEGG   Mus caroli (Ryukyu mouse): 110295504
Entry
110295504         CDS       T05910                                 

Gene name
Col4a4
Definition
(RefSeq) collagen alpha-4(IV) chain
  KO
K06237  collagen type IV alpha
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04151  PI3K-Akt signaling pathway
mcal04510  Focal adhesion
mcal04512  ECM-receptor interaction
mcal04926  Relaxin signaling pathway
mcal04933  AGE-RAGE signaling pathway in diabetic complications
mcal04974  Protein digestion and absorption
mcal05146  Amoebiasis
mcal05165  Human papillomavirus infection
mcal05200  Pathways in cancer
mcal05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    110295504 (Col4a4)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    110295504 (Col4a4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110295504 (Col4a4)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    110295504 (Col4a4)
  09154 Digestive system
   04974 Protein digestion and absorption
    110295504 (Col4a4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110295504 (Col4a4)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    110295504 (Col4a4)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    110295504 (Col4a4)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    110295504 (Col4a4)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    110295504 (Col4a4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcal04147]
    110295504 (Col4a4)
   00536 Glycosaminoglycan binding proteins [BR:mcal00536]
    110295504 (Col4a4)
Exosome [BR:mcal04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   110295504 (Col4a4)
Glycosaminoglycan binding proteins [BR:mcal00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   110295504 (Col4a4)
SSDB
Motif
Pfam: Collagen C4
Other DBs
NCBI-GeneID: 110295504
NCBI-ProteinID: XP_021019666
Ensembl: MGP_CAROLIEiJ_G0014327
LinkDB
Position
1
AA seq 1647 aa
MRCFFRWTKSFVTAPWSLIFILFTIQYEYGSGKKYGGPCGGRNCSVCQCFPEKGSRGHPG
PLGPQGPIGPLGPPGPLGIPGEKGERGDSGSPGPPGEKGDKGPTGVPGFPGVDGIPGHPG
PPGPRGKPGVDGYNGSRGDPGYPGERGAPGPGGPPGQPGENGEKGRSVYISGGVKGIQGD
RGDPGPPGLPGSRGAQGSPGPMGHAGTPGLAGPIGHPGSPGLKGNPATGLKGQRGDPGEV
GQRGPPGPTLFVQPPDLRIYKGEKGVKGMPGMIGPPGPPGRKGEPGVGIKGEKGIPGFPG
PRGEPGSHGSPGFPGFKGIQGAAGEPGLLGFLGPKGDPGDRGYPGPPGILLTPAPPLKGM
MGPPGPPGVPGPPGFPGEAGIPGRLDCAPGKPGKPGLPGLPGAPGPEGPPGSDVIYCGPG
CPGPMGEKGKVGPPGRRGAKGAKGNEGLCTCPPGPMGPPGPPGPPGRQGSKGDLGLPGWH
GEKGDPGQPGAEGPPGPPGRPGAMGPPGHKGEKGDMVISRVKGQKGERGLDGPPGFLGPP
GQDGGGGRPGERGDPGPRGDHKDAAPGERGLPGLPGPPGRTGPVGSPGLGFPGPPGQRGL
PGEPGRPGMRGFDGSKGQKGDSILCNVSYPGKPGLPGLDGPPGLKGFPGPPGAPGMRCPD
GQKGQRGKPGMSEIPGPPGFRGDMGDPGIKGEKGTSPIGPPGPPGSPGKDGQKGIPGDPA
FGDPGPPGERGLPGTPGMKGQKGHPGCPGAGGPPGIPGSPGLKGPKGREGSRGLPGILGS
PGHSCERGAPGIPGQPGLPGTPGDPGAPGWKGQPGDMGPSGPAGMKGLPGLPGLPGADGL
RGPPGIPGPTGEDGLPGLPGLKGLPGLPGFPGFPGERGKSGPDGEPGGKGEVGEKGWPGL
KGDLGERGPKGDRGLRGDAGEAVISIKGEPGDAGPPGDGGFSGERGDKGSPGMRGGRGDP
GRDGPPGLHRGQPGIDGPPGPPGPPGLPGSPGLRGVIGFPGFPGDQGDPGSPGPPGFPGD
DGARGPKGYKGDPASQCGPPGPKGEPGSPGYQGHTGAPGEKGFPGDEGPRGPPGRPGQPG
SLGPPGCPGDPGMPGLKGHPGEVGDPGPRGYAGDFGRPGPAGVKGPPGSPGLNGLHGLKG
EKGTKGTSGLLEMGPPGPMGMPGQKGEKGDPGSPGISPPGLPGEKGFPGPPGRPGPPGPA
GAPGRAAKGDIPDPGPPGDWGPPGPDGPRGVPGPPGSPGNVDLLKGDPGDCGLPGPPGSR
GPPGPPGCQGPPGCDGKDGQKGPMGLPGLPGPPGLPGAPGEKGLPGPPGRKGPVGPPGCR
GEPGPPADVDSCPRIPGLPGVPGPRGPEGAMGDPGQRGLPGPGCKGEPGPDGRRGQDGIP
GSPGPPGRKGDTGEAGCPGAPGPPGPTGDPGPKGFGPGSLSGFLLVLHSQTDQEPACPVG
MPRLWTGYSLLYMEGQEKAHNQDLGLAGSCLPVFSTLPFAYCNIHQVCHYAQRNDRSYWL
SSAAPLPMMPLSEEEIRPYISRCAVCEAPAQAVAVHSQDQSIPPCPRTWRSLWIGYSFLM
HTGAGDQGGGQALMSPGSCLEDFRAAPFLECQGRQGTCHFFANEYSFWLTTVNPDLQFAS
GPSPDTLKEVQAQRRKISRCQVCMKHS
NT seq 4944 nt   +upstreamnt  +downstreamnt
atgaggtgctttttcagatggaccaagtcctttgtcacagccccctggtcactaatattt
atcctctttactatacaatatgaatatgggagtggcaagaagtatggcggcccctgcgga
ggaagaaactgctctgtctgccagtgttttcctgagaagggatctcggggtcacccagga
ccactgggaccacagggaccaatagggcccttgggacccccaggacctcttgggattcca
ggagaaaaaggagagagaggggacagtggctcacctggaccaccaggagagaaaggagac
aagggtccaactggtgtccctggatttccaggtgtggatggtatacctggtcacccaggg
cctcccggacccagaggcaaacctggtgtggacggctacaatggctcacgaggtgatccg
ggctatccaggagaaagaggagctccaggcccaggtggcccccctggtcagcctggggaa
aatggagaaaaaggaagatctgtgtacatttctggtggcgttaaaggtattcagggagac
cgtggggacccaggaccacccggcttaccaggatctaggggtgcacaaggatcaccaggg
cccatggggcatgcaggcacaccagggctagcaggacctataggtcatcctgggagccct
gggttgaagggaaatcctgccactggactgaaggggcaaaggggagatccgggtgaagtt
ggccagcgtggtcctcctgggcccacgctgttcgtacagccacctgatttgagaatctat
aaaggagaaaagggtgtaaaaggaatgcctggaatgattggccccccaggacctccaggt
cgcaagggagagcctggtgtcgggatcaaaggagagaaaggtatccctgggttcccagga
ccccggggtgagcctggttcacatggatctccaggttttccaggattcaaggggatacaa
ggagcagctggagagcctgggctgctcggatttcttggtccaaagggggatcctggagat
cgcgggtacccaggaccaccaggcattttgttgactccagctccaccactcaaaggcatg
atgggacctcctggaccaccaggggttcctggtcctccaggatttccaggagaagctggt
attcctggaagactcgactgtgccccaggaaaacctgggaagccagggctacccggcctg
cctggcgcaccaggaccagaggggccccctggatcagatgtgatatactgtggccctggg
tgccctgggccaatgggtgaaaagggaaaagtgggtcctccaggaagaagaggagccaaa
ggagcaaaaggaaacgagggactctgtacctgtccacctggtcccatgggaccccctggt
cccccaggacctcctggaagacaaggaagtaaaggagatttagggctccctggttggcat
ggagaaaagggtgatccaggtcagcctggtgctgaaggacctccagggccaccaggaaga
cctggtgccatggggccccctggtcacaaaggggaaaagggtgacatggtcatatcaaga
gtgaaagggcaaaaaggagaaagaggactggatgggccaccaggatttttggggccacct
ggacaagatggtgggggtggacgtcctggagaaagaggggatcctgggccacgaggggac
cataaggatgcagccccaggtgagagagggcttcctggactgccaggccctccaggaaga
acaggacctgtggggtctccaggcctgggatttccaggcccaccaggacagcgaggccta
ccaggagagcccgggcgcccgggcatgagaggctttgatggctcgaaggggcaaaaaggt
gactccattctgtgtaatgtaagctacccaggaaaaccaggtctgccaggtcttgatgga
cctccaggtctgaaggggtttccaggccccccaggggctcctggtatgagatgtccagat
gggcagaaaggccagcggggcaaaccgggaatgtctgagattccaggtccacctggtttt
cgtggtgacatgggagatccaggcatcaaaggtgaaaaggggacctcccctattggaccc
ccaggcccacctgggtctcctggaaaggatggccagaaaggaatcccaggagaccctgca
tttggtgacccaggaccccctggagagaggggtcttccaggaacaccaggcatgaaagga
cagaaaggtcacccagggtgcccaggggctggaggccctcctggcatccctggatctcca
ggtctcaaaggtcccaaaggtagagagggaagtcgtggcttaccagggatcctaggctcc
cctggccattcctgtgaaagaggtgctccggggatcccaggacaaccgggacttcctgga
actccaggtgatccaggggccccaggttggaaaggccagccaggagacatgggtccctct
ggaccagctgggatgaagggcctccctggtctcccaggcctaccaggagctgatggtctc
cgagggcctcctgggattccaggccccactggggaagatggtctacctggtcttccaggc
ctaaaggggctcccagggctgcctggcttccctggttttccaggagagagaggaaagtca
gggccagatggagaacctggaggaaagggagaggttggagagaaaggctggcctggcttg
aagggagacctgggagagcgaggccccaaaggagacagaggacttcgtggtgatgcagga
gaagcagtcatttccataaagggtgaacctggggatgctgggcctccaggagatggtggg
ttctcaggagaaagaggtgataaaggaagcccagggatgcgagggggaagaggtgatccc
ggaagagatggaccaccgggactccacagagggcagcctgggatagatgggcctcctggg
cctcctggcccccctggccttccaggatcacctggactgagaggagtcattggttttcca
ggatttccaggtgaccagggtgatccaggctctccaggaccccctggattcccaggagat
gatggagcaagaggacctaaaggatacaaaggcgaccctgccagtcagtgtggtccaccc
ggtccaaagggtgagccaggtagccctggataccaaggacatactggagcccctggagag
aaaggctttcctggagacgaaggaccccgaggaccaccaggcagacctggacagcctggc
tctttgggaccaccagggtgtccaggtgacccagggatgcccggactcaagggacatcca
ggagaagtgggagaccctggaccaagaggttatgcgggagattttgggaggccaggtccc
gctggagtgaaagggcctcccgggtctcctggtctgaatggcttacacggtctgaagggt
gagaaaggaacaaaaggcacctcaggtttgctcgaaatgggtccacctgggccaatgggg
atgcctgggcaaaaaggagagaaaggagaccctgggagtccagggatttctcctccaggt
cttcctggagaaaagggcttcccaggacccccaggaagaccaggaccacctggtcccgca
ggtgccccaggaagagctgctaaaggtgacattcctgatccaggtccacctggagactgg
ggacctcctggccccgatggcccaagaggagtacctgggcctccgggttcccctgggaat
gttgaccttctgaaaggggatccaggtgactgtggtttgccaggaccacctggctcccga
ggcccaccaggccctccagggtgtcagggtcccccaggatgtgatggcaaagatggccag
aaaggaccaatgggacttccagggttgccagggccacctggtcttcctggggcacctggc
gagaagggattacctggccctccaggcagaaaagggccagtaggtcctccaggctgcaga
ggtgaacctgggcctcctgcagacgtggattcctgtcctcgaatcccaggacttcctgga
gtgccaggtcccagaggaccagaaggagctatgggggaccctggacagagaggcctgcct
ggaccagggtgcaaaggagagccaggaccggatggcagaaggggccaggatggcatccct
ggatctcccgggcctcctggacgcaaaggtgacactggagaggcagggtgtcctggagca
ccaggccctcctggtccaactggtgatcctgggcccaaggggtttggccctggatccctc
agtggcttcctcctggttctccacagtcagacagaccaggaaccggcctgccccgtgggc
atgcctcggctttggacagggtacagcttgttgtacatggaaggacaggagaaggcacac
aatcaagatcttggtttggcaggctcttgtcttcctgtgtttagcactctgccctttgcc
tactgcaacatccaccaagtgtgccactatgcccagagaaatgacaggtcctactggctg
tccagtgcagctcctcttcctatgatgccactctcagaggaagagatccgcccttacatc
agccgctgtgcggtgtgtgaggccccagcacaggccgtggcggtccacagtcaggaccaa
tccatcccaccgtgtccacggacatggaggagcctctggattgggtactcatttctgatg
cacactggagctggggaccaaggaggcgggcaggcgctgatgtcacctggcagctgccta
gaggacttcagagctgcaccgttccttgaatgccagggccgacagggaacctgtcacttt
tttgcaaacgagtacagcttctggctgaccaccgtgaacccagacctgcagtttgcctct
ggcccgtcaccagacaccttgaaagaagttcaggcccagcgccggaaaatcagcaggtgc
caggtttgcatgaagcacagctaa

KEGG   Mus caroli (Ryukyu mouse): 110299671
Entry
110299671         CDS       T05910                                 

Gene name
Col4a1
Definition
(RefSeq) collagen alpha-1(IV) chain
  KO
K06237  collagen type IV alpha
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04151  PI3K-Akt signaling pathway
mcal04510  Focal adhesion
mcal04512  ECM-receptor interaction
mcal04926  Relaxin signaling pathway
mcal04933  AGE-RAGE signaling pathway in diabetic complications
mcal04974  Protein digestion and absorption
mcal05146  Amoebiasis
mcal05165  Human papillomavirus infection
mcal05200  Pathways in cancer
mcal05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    110299671 (Col4a1)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    110299671 (Col4a1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110299671 (Col4a1)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    110299671 (Col4a1)
  09154 Digestive system
   04974 Protein digestion and absorption
    110299671 (Col4a1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110299671 (Col4a1)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    110299671 (Col4a1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    110299671 (Col4a1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    110299671 (Col4a1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    110299671 (Col4a1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcal04147]
    110299671 (Col4a1)
   00536 Glycosaminoglycan binding proteins [BR:mcal00536]
    110299671 (Col4a1)
Exosome [BR:mcal04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   110299671 (Col4a1)
Glycosaminoglycan binding proteins [BR:mcal00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   110299671 (Col4a1)
SSDB
Motif
Pfam: Collagen C4
Other DBs
NCBI-GeneID: 110299671
NCBI-ProteinID: XP_021025073
Ensembl: MGP_CAROLIEiJ_G0030814
UniProt: A0A6P5QCG0
LinkDB
Position
8
AA seq 1669 aa
MGPRLSVWLLLLLAALLLHEERSRAAAKGDCGGSGCGKCDCHGVKGQKGERGLPGLQGVI
GFPGMQGPEGPHGPPGQKGDAGEPGLPGTKGTRGPPGAAGYPGNPGLPGIPGQDGPPGPP
GIPGCNGTKGERGPLGPPGLPGFSGNPGPPGLPGMKGDPGEILGHVPGTLLKGERGFPGI
PGMPGSPGLPGLQGPVGPPGFTGPPGPPGPPGPPGEKGQMGSSFQGPKGDKGEQGVSGPP
GVPGQAQVKEKGDFAPTGEKGQKGEPGFPGAPGYGEKGEPGKQGPRGKPGKDGEKGEKGS
PGFPGDSGYPGLPGRQGPQGEKGEAGLPGPPGTVIGTRPLGEKGDRGYPGAPGLRGEPGP
KGFPGTPGQPGPPGFPTPGQAGAPGFPGERGEKGDQGFPGVSLPGPSGRDGAPGPPGPPG
PPGQPGHTNGIVECQPGPPGDQGPPGTPGQPGLTGEVGQKGQKGESCLACDTEGLRGPPG
PQGPPGEIGFPGQPGAKGDRGLPGRDGLEGLPGPQGSPGLIGQPGAKGEPGEIFFDMRLK
GDKGDPGFPGQPGMPGRAGTPGRDGHPGLPGPKGSPGSIGLKGERGPPGGVGFPGSRGDI
GPPGPPGVGPIGPVGEKGQAGFPGGPGSPGLPGPKGEAGKVVPLPGPPGAAGLPGSPGFP
GPQGDRGFPGTPGRPGIPGEKGAVGQPGIGFPGLPGPKGVDGLPGEIGRPGSPGRPGFNG
LPGNPGPQGQKGEPGIGLPGLKGQPGLPGIPGTPGEKGSIGGPGVPGEQGLTGPPGLQGI
RGDPGPPGVQGPAGPPGVPGIGPPGAMGPPGGQGPPGSSGPPGIKGEKGFPGFPGLDMPG
PKGDKGSQGLPGLTGQSGLPGLPGQQGTPGVPGFPGSKGEMGVMGTPGQPGSPGPAGTPG
LPGEKGDHGLPGSSGPRGDPGFKGDKGDVGLPGMPGSMEHVDMGSMKGQKGDQGEKGQIG
PTGDKGSRGDPGTPGVPGKDGQAGHPGQPGPKGDPGLSGTPGSPGLPGPKGSVGGMGLPG
SPGEKGVPGIPGSQGVPGSPGEKGAKGEKGQSGLPGIGIPGRPGDKGDQGLAGFPGSPGE
KGEKGSAGTPGMPGSPGPRGFPGNIGHPGSPGLPGEKGDKGLPGLDGVPGVKGEAGLPGT
PGPTGPAGQKGEPGSDGIPGSAGEKGEPGTPGKGLPGFPGSKGDKGSKGEVGFPGLAGSP
GIPGVKGEQGFMGPPGPQGQPGLPGTPGHPVEGPKGDRGPQGQPGLPGHPGPMGPPGFPG
INGPKGDKGNQGWPGAPGIPGPKGDPGFQGMPGIGGSPGITGSKGDMGLPGVPGFQGQKG
LPGLQGVKGDQGDQGVPGPKGLQGPPGPPGPYDVIKGEPGLPGPEGPPGLKGLQGPPGPK
GQQGVTGSVGLPGPPGVPGFDGAPGQKGETGPFGPPGPRGFPGPPGPDGLPGSMGPPGTP
SVDHGFLVTRHSQTTDDPLCPPGTKILYHGYSLLYVQGNERAHGQDLGTAGSCLRKFSTM
PFLFCNINNVCNFASRNDYSYWLSTPEPMPMSMAPISGDNIRPFISRCAVCEAPAMVMAV
HSQTIQIPQCPNGWSSLWIGYSFVMHTSAGAEGSGQALASPGSCLEEFRSAPFIECHGRG
TCNYYANAYSFWLATIERSEMFKKPTPSTLKAGELRTHVSRCQVCMRRT
NT seq 5010 nt   +upstreamnt  +downstreamnt
atggggccccggctcagcgtctggcttctgctgctgctcgccgcccttctgctccacgag
gagcgcagccgagccgctgcgaagggcgattgtggtggctctggctgtggaaaatgtgac
tgtcatggcgtgaagggacaaaagggagaaagaggcttgccagggttacaaggtgtcatt
ggatttcctgggatgcaaggacctgaggggccacatggaccaccaggacaaaagggtgat
gctggagaacctggacttcctggcacaaaagggacgaggggaccccctggagcagctggc
taccctgggaatcccggacttcctggcattcctggccaagatggccctccaggtccccca
ggtatcccaggatgcaacggtacaaagggagagagagggccgctcggtcctcctggcttg
cctggattcagcgggaatcctggaccaccagggttaccaggaatgaagggagatcctggt
gaaattctcggccacgttcctggaacactgctgaaaggggagagaggatttcctggtatc
cccgggatgccgggctcaccagggttgccaggactgcagggacctgtgggtcctccggga
tttactggaccaccgggtcctccaggccctcctggacctcctggagaaaaggggcagatg
ggctccagcttccaaggaccaaaaggtgacaagggagagcaaggggtcagtggtcccccg
ggagttcctggacaggcacaagttaaggaaaaaggagactttgccccaacaggagaaaag
ggtcagaaaggtgaacccggattcccgggagcaccagggtatggagagaaaggtgaacct
ggcaagcaagggcctcggggaaaacctgggaaagacggtgaaaaaggagaaaaggggagc
ccgggctttcctggcgattccgggtacccaggtctcccaggccggcagggcccgcaggga
gagaagggtgaagctggacttccaggtccccccggaactgtgataggcaccaggcctttg
ggagagaaaggagatcgaggctacccaggagcaccagggttgagaggagagcctggccct
aaaggtttccctggaacaccaggccaaccaggccctccaggcttccctactccaggccag
gctggtgctccaggcttccccggtgaaaggggagaaaaaggtgaccagggatttccaggc
gtgtcattaccaggaccaagtggaagagatggagccccagggcctcccggccctcctggc
ccccctgggcagccaggccacacaaatggcattgtggagtgtcaacctggaccacccggg
gaccagggccctcctgggactccaggacagccaggtttgacaggtgaagttggacagaaa
ggtcagaaaggagagagctgccttgcctgtgacacagaaggtcttcgtggccctccaggg
ccacaggggcctccgggagagattggtttccctggacaacctggggctaaaggtgaccga
ggcctgcccggcagagatggtcttgaaggattgccgggtccacaaggttcaccagggctt
ataggccagcctggagctaagggagagcctggagagatattttttgacatgcgactcaaa
ggtgacaaaggagacccaggttttccaggacagcctggcatgccaggaagagcaggaact
cccggaagagatggccacccaggactccctggacccaaaggctctccgggttcaatagga
ttgaaaggagagcgaggtccccccggaggagttggcttccctggtagtcgtggagacatc
ggccctcctggacccccaggagttggtcccattggtcctgttggtgaaaaaggacaagca
ggctttcctggaggccctgggtccccaggtcttccaggcccaaagggtgaggcaggaaag
gttgtcccactccctggccccccaggagctgcaggacttccaggatcccctgggttccca
gggccacaaggtgaccgaggcttcccaggaaccccaggacgtccaggcatcccaggagag
aaaggtgctgtgggccagccgggaattggatttcctgggcttcctggccccaaaggtgtt
gatggcttgcctggagagataggacggcctggaagtccaggtcgccctggatttaacggc
ttacctggcaacccaggacctcaaggtcaaaagggagaacctggcattgggcttccaggg
ctcaaagggcaaccaggccttccaggcattcccggcacacctggcgagaagggcagcatc
gggggaccaggcgttccaggagaacaggggttgactggccccccaggactgcaggggatc
agaggtgacccaggacctcctggagttcaaggccccgcaggtccaccaggggtcccagga
atagggccacccggagctatgggccctcccggagggcaaggaccaccagggtcatcaggt
ccacctggaattaaaggagagaaagggttccctggattcccaggactggatatgcctggc
cccaaaggcgataaaggctctcaaggacttcctggcctcacaggacagtcaggcctccct
ggccttcctggacagcaggggacacctggagttccagggttcccaggttctaaaggtgaa
atgggcgtcatgggaaccccgggacaaccaggctcgccaggaccagcaggcaccccaggc
ttacctggagaaaaaggggaccatggccttccgggctcctcaggacccaggggcgaccct
ggcttcaaaggtgataaaggtgacgttgggcttcctggcatgccaggatccatggagcat
gtggacatggggagcatgaagggacagaaaggagaccagggagagaaaggacaaatcgga
cccactggtgataaaggttcccgaggagaccctggaacgccaggagtacctgggaaggat
gggcaggcagggcatcccggacagccagggcctaaaggtgacccaggccttagtgggaca
ccaggatcccctggactccctggacccaaaggatcagttggaggaatgggcttgccaggt
tcgcctggagaaaaaggtgtgcctggcatccctggctcacagggtgtccctggctcacct
ggagagaagggagccaaaggagagaaagggcagtcaggtctacctggcattgggattccg
ggacggcctggtgacaagggagaccagggccttgcaggcttcccaggcagccccggtgag
aagggagagaaaggcagtgccggaaccccagggatgccagggtccccaggcccgagaggt
tttccggggaacatcggccatccaggaagcccaggcctgcctggagagaaaggggataaa
ggcctcccaggactggatggcgttcctggtgtcaaaggagaagcaggtctccctgggact
cctggccccacaggcccagctggtcagaagggagagcccggcagcgatggaatcccgggg
tcggcaggagagaagggtgaaccaggtactccaggaaaaggcttacccggcttcccaggc
tccaaaggagacaaaggctccaagggtgaagtgggcttccctggcctagcaggaagtcct
ggaattcctggagtcaaaggcgagcaagggttcatgggtcctcccggccctcaaggacaa
cctggcttacctggcactcctggtcaccctgtggaggggcccaaaggagaccgaggacct
cagggtcaacctggcctgccagggcatccgggacctatggggccgccagggttcccagga
atcaatgggccaaaaggtgacaagggaaatcaaggttggccaggagctccggggattcca
ggccctaagggagacccgggattccaaggcatgccgggcattggcggctctccagggatc
acaggttcaaagggagatatgggactgcccggagttccaggatttcaaggtcagaaaggc
cttcctggtctgcagggagtgaagggagatcagggagaccaaggtgtacccggccctaaa
ggtctccaaggtccccctgggcccccaggtccctacgatgtcatcaaaggagaaccaggg
ctccctggtcctgagggtccccctggtcttaaaggactccagggaccaccaggtccaaaa
ggacagcaaggtgtgacaggctcagtgggcttgcctggacctccaggtgtccctgggttc
gatggtgcccctggccagaaaggagagacaggaccctttggaccacctggtccaagaggg
tttcctggcccaccaggccccgatgggctgccaggatccatgggtcccccaggtacccca
tctgtggaccatggcttccttgtcaccaggcatagtcagacaacagatgacccactgtgt
cccccagggaccaaaattctttaccatggatactctctgctctacgtccaaggcaacgag
cgtgcccatgggcaggacttgggtacggctggcagctgcctgcgcaagttcagcacaatg
ccttttctcttctgcaacatcaacaacgtctgcaacttcgcctccaggaacgactactcc
tactggctgtccacgccagagcccatgcccatgtccatggcacccatctctggggacaac
atccggcccttcattagcaggtgtgcggtttgcgaagcgccggccatggtgatggcggta
cacagtcagaccattcagattccgcagtgccccaacggttggtcctcactgtggatcggc
tactccttcgtgatgcacaccagcgctggtgctgaaggttccggccaagccctcgcatcc
cccgggtcctgtctggaagagtttagaagcgccccattcatcgagtgccacggcagagga
acgtgcaattactacgcaaatgcttacagcttttggctcgccaccatagagagaagcgag
atgttcaagaagcccacgccgtccaccttgaaggcaggggagctgcgcacgcacgtcagc
cgctgccaagtgtgcatgagaagaacataa

KEGG   Mus caroli (Ryukyu mouse): 110299672
Entry
110299672         CDS       T05910                                 

Gene name
Col4a2
Definition
(RefSeq) collagen alpha-2(IV) chain
  KO
K06237  collagen type IV alpha
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04151  PI3K-Akt signaling pathway
mcal04510  Focal adhesion
mcal04512  ECM-receptor interaction
mcal04926  Relaxin signaling pathway
mcal04933  AGE-RAGE signaling pathway in diabetic complications
mcal04974  Protein digestion and absorption
mcal05146  Amoebiasis
mcal05165  Human papillomavirus infection
mcal05200  Pathways in cancer
mcal05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    110299672 (Col4a2)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    110299672 (Col4a2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110299672 (Col4a2)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    110299672 (Col4a2)
  09154 Digestive system
   04974 Protein digestion and absorption
    110299672 (Col4a2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110299672 (Col4a2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    110299672 (Col4a2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    110299672 (Col4a2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    110299672 (Col4a2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    110299672 (Col4a2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcal04147]
    110299672 (Col4a2)
   00536 Glycosaminoglycan binding proteins [BR:mcal00536]
    110299672 (Col4a2)
Exosome [BR:mcal04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   110299672 (Col4a2)
Glycosaminoglycan binding proteins [BR:mcal00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   110299672 (Col4a2)
SSDB
Motif
Pfam: Collagen C4
Other DBs
NCBI-GeneID: 110299672
NCBI-ProteinID: XP_021025074
Ensembl: MGP_CAROLIEiJ_G0030815
UniProt: A0A6P5Q5J0
LinkDB
Position
8
AA seq 1707 aa
MDRVRFKASGPPLRGWLLLATVTVGLMAQSVLGGVKKLDVPCGGRDCSGGCQCYPEKGAR
GQPGAVGPQGYSGPPGLQGFPGLQGRKGDKGERGVPGPTGPKGDVGARGVSGFPGADGIP
GHPGQGGPRGRPGYDGCNGTRGDAGPQGPSGSGGFPGLPGPQGPKGQKGEPYALSKEDRD
KYRGEPGEPGLVGYQGPPGRPGPIGQMGPMGAPGRPGPPGPPGPKGQPGNRGLGFYGQKG
EKGDIGQPGPNGIPSDITLVGPTTSTIHPDLYKGEKGDEGEQGIPGVISKGEEGIMGFPG
IRGFPGLDGEKGVLGQKGSRGLDGFQGPSGPRGPKGERGEQGPPGPSVYSPHPSLAKGAR
GDPGFQGAHGEPGSRGEPGEPGTAGPPGPSIGDEDSMRGLPGEMGPKGFSGEPGPPARYP
GPPGADGRPGPQGVPGPAGPPGPDGFLFGLKGSEGRVGYPGPSGFPGTRGQKGWKGEAGD
CQCGQVIGGLPGLPGPKGFPGVNGELGKKGDQGDPGLHGIPGFPGFKGAPGIAGAPGPKG
IKGDSRTVTTKGERGQPGIPGVHGMKGDDGVPGRDGLDGFPGLPGPPGDGIKGPPGDAGL
PGVPGTKGFPGDVGPPGQGLPGPKGERGFPGDAGLPGPPGFPGPPGPPGTPGQRDCDTGV
KRPIGGGQQVIVQPGCIEGPTGSPGQPGPPGPTGAKGIRGMPGFPGASGEQGLKGFPGDP
GREGFPGPPGFMGPRGSKGTTGLPGPDGPPGPIGLPGPAGPPGDRGIPGEVLGAQPGTRG
DAGLPGQPGLKGLPGETGAPGFRGSQGMPGMPGLKGQPGFPGPSGQPGQSGPPGQHGFPG
TPGREGPLGQPGSPGLGGLPGDRGEPGDPGVPGPVGMKGLSGDRGDAGMSGERGHPGSPG
FKGMAGMPGIPGQKGDRGSPGMDGFQGMLGLKGRPGFPGTKGEAGFFGVPGLKGLPGEPG
VKGNRGDRGPPGPPPLILPGMKDIKGEKGDEGPMGLKGYLGLKGIQGMPGVPGVSGFPGL
PGRPGFIKGVKGDIGVPGTPGLPGFPGVSGPPGITGFPGFTGSRGEKGTPGVAGVFGETG
PTGDFGDIGDTVDLPGSPGLKGERGITGIPGLKGFFGEKGAEGDIGFPGITGMAGAQGSP
GLKGQTGFPGLTGLQGPQGEPGRVGIPGDKGDFGWPGVPGLPGFPGIRGISGLHGLPGTK
GFPGSPGVDANGDPGYPGPTGDRGDRGEANTLPGPVGVPGQKGERGTPGERGPAGSPGLQ
GFPGISPPSNISGSPGDVGAPGIFGLQGYQGPPGPPGPNALPGIKGDEGSSGAAGFPGEK
GWVGDPGPQGQPGVLGLPGEKGPKGEQGFMGNTGPSGAVGDRGPKGPKGDQGFPGAPGSM
GSPGIPGIPQKIAAQPGTLGPQGRRGLPGALGEIGPQGPPGDPGFRGAPGKAGPQGRGGV
SAVPGFRGDQGPMGHQGPVGQEGEPGRPGSPGLPGMPGRSVSIGYLLVKHSQTDQEPMCP
VGMNKLWSGYSLLYFEGQEKAHNQDLGLAGSCLARFSTMPFLYCNPGDVCYYASRNDKSY
WLSTTAPLPMMPVAEEEIKPYISRCSVCEAPAVAIAVHSQDTSIPHCPAGWRSLWIGYSF
LMHTAAGDEGGGQSLVSPGSCLEDFRATPFIECNGGRGTCHYFANKYSFWLTTIPEQNFQ
STPSADTLKAGLIRTHISRCQVCMKNL
NT seq 5124 nt   +upstreamnt  +downstreamnt
atggaccgagtgcggttcaaagcgtctggccctcccctgcgagggtggctgctgctagcg
actgtgacagtgggactcatggctcagagcgtcttggggggtgtgaagaagttggatgtg
ccctgcggagggagagactgcagtgggggttgccagtgctacccggagaaaggagcaagg
ggtcagccaggggcagtgggcccccaggggtacagtggccccccagggttgcaaggattc
ccaggactacagggccgcaaaggagacaagggcgaacggggagttcctggaccaactgga
ccaaaaggagatgtgggagcgagaggcgtctctggattccccggtgcagatggaattcct
gggcatccagggcaaggtggaccccgaggaaggccaggctacgatggttgcaacggaacc
aggggagacgcaggtccacaggggccctctggatctgggggcttccctggcctccctggg
ccccaaggacccaaggggcagaaaggcgagccttacgcactctctaaagaagaccgtgac
aaataccggggtgaacctggagagcctggcctggttggctaccagggacctcctggccgc
ccagggcccataggacagatgggtcccatgggagcacctggaagaccgggaccaccggga
ccccctggaccaaagggacaaccaggcaaccgagggctcggtttttacggacagaagggt
gaaaagggtgacataggacagccaggacccaacgggatcccatctgacatcacacttgtt
gggcccacaacatcaacgatccacccggatctgtacaagggtgaaaaaggagatgaagga
gagcaagggatacccggcgtaatctcaaaaggcgaggaaggcatcatggggttcccagga
atacggggttttcctggccttgatggagaaaaaggagtcttaggacagaaaggaagcaga
ggcctggatggtttccaaggccccagtggacctcgaggacccaagggagaacggggggaa
caaggacccccaggaccctctgtctactcgccccatccatccctggcaaaaggtgcccga
ggtgacccaggattccaaggtgctcatggggagccagggagccgaggtgaaccaggagag
cctggaaccgcgggtcctccaggcccatccatcggagatgaagattcaatgagaggcctt
ccaggggagatgggacccaaaggcttctcaggagaaccagggccccctgcacgctatcct
ggcccaccaggagcagatggaagaccaggtccccaaggagtccctggacctgcaggccca
cctggaccagatggcttcctgtttggcctgaaaggatcagaagggagagtgggctatccg
ggaccttcaggtttcccaggaacacgagggcagaaaggatggaaaggtgaagctggagac
tgccaatgtggccaggtcatcgggggtcttccgggactgccaggacccaaaggttttccc
ggtgtcaatggggagctcggaaagaaaggcgaccaaggagacccaggcctgcacggtatc
cctgggttcccaggattcaagggggccccgggcattgctggagctcctggacccaaagga
ataaagggagactctagaacagtcaccaccaaaggtgagcgaggacagccaggtatccct
ggtgtacatggaatgaaaggtgatgatggcgtcccaggacgtgatgggctggatggattc
cctggtctgcctggtcccccgggtgatggcatcaaaggccctccaggggatgcaggtctc
cctggtgtacctggaaccaagggctttccaggagacgtcggtcctccaggacagggctta
ccaggcccgaaaggcgagcgtggtttccctggagacgctgggttgcctggacctccgggc
ttccctggtcctccaggtcccccaggaaccccaggacagagagattgtgacacgggtgtg
aaaagacctatcggaggcggccagcaagtgatcgttcagccaggttgcattgaaggcccc
acaggatcacctggccagccaggacccccaggccccacaggtgccaaaggcatcagagga
atgccaggattcccaggagcctctggagaacaagggctcaagggctttcccggagaccca
ggtcgagaaggcttcccagggcccccagggttcatgggaccccgaggatccaaaggtacc
acgggcctccctggcccagatggacccccaggccccattggacttccaggaccagctgga
ccccctggggacagagggattccaggagaagtgctaggggcccagcctgggacccgagga
gatgctggacttccaggacagcctgggctgaaagggctcccaggagaaacaggagcaccg
ggattcagaggaagccaagggatgcctgggatgccagggcttaaaggtcagccaggcttc
ccaggaccttcgggacagccaggacagtctgggcccccaggacaacatggattcccagga
actcctggccgagaggggcctttgggacagccaggctcccctggccttggaggtttgcct
ggagacaggggtgagcctggtgaccctggtgtccctggccctgtgggcatgaaaggtctg
tctggggacagaggtgacgccggtatgtcaggcgagcgtggtcatcctggaagccctgga
tttaaaggaatggcagggatgcctggtatccctgggcaaaaaggtgatcgagggtcgcct
ggaatggatggtttccagggcatgttgggacttaagggaagaccgggcttcccggggacc
aaaggagaagctggattttttggagttcctggtttgaagggcctgcctggcgagccaggg
gttaaaggaaaccgaggagaccggggccccccaggaccacctcctctcatcctgccgggg
atgaaggacatcaagggagaaaagggagatgaaggaccaatgggcctgaaagggtacctg
ggcttaaaaggcatccaaggaatgcccggggtccccggggtgtctggattccctgggcta
cctggaaggcctggcttcatcaaaggagtcaagggagacatcggagtccctggcacacca
ggcttgccgggatttcctggggtgtctggccctcctggaattaccgggttcccaggattc
acaggcagccggggcgagaagggtactccaggagtagcaggagtctttggcgagaccggc
cctactggggactttggggacattggggacactgtggacttaccaggaagcccaggcctg
aagggggaacggggcatcacgggaattccaggtctcaagggattctttggagagaaagga
gctgagggtgacattggatttcctgggataacgggcatggctggagctcagggctctcct
ggacttaaaggacagacaggctttccagggctcacagggctgcaagggccacagggagag
cctggacgggtcggaataccgggtgacaagggtgatttcggctggccaggcgtaccaggt
ctaccaggttttcctgggatccgggggatcagcggattgcacggcctgccaggcaccaag
ggcttccctggatccccaggtgttgatgctaatggagacccagggtacccaggccccacc
ggagacaggggtgaccggggagaggccaacacacttccaggccccgtgggagttccaggg
cagaaaggggagcggggaaccccaggggagcgtggcccagctgggagcccaggacttcag
ggtttccccggtatctctccaccatccaacatctctgggtcacctggtgatgtaggcgca
ccaggaatatttggcttgcaaggctaccaaggccctccaggaccacctgggccaaatgca
cttcctggaatcaaaggagatgaggggagctctggagccgcaggattccctggagagaaa
ggatgggttggggacccagggccccagggccagcctggtgtactcggtcttccgggggag
aaagggcccaagggtgaacaaggattcatgggcaacaccgggccctctggggccgtgggt
gacagaggccccaaaggacccaaaggcgaccaaggattcccaggtgctcctggctctatg
ggatccccaggaattcctggcatcccccagaagattgctgcccagcctgggacgctgggt
ccccagggcaggagaggccttcctggtgccctgggagagatagggcctcagggccctcct
ggagatccaggtttccgtggggccccaggcaaggctgggcctcagggcagaggtggcgtg
tctgctgttccagggttccggggagaccaagggcccatgggacaccagggtccagttggc
caggaaggggaaccaggccgtccagggagcccaggcctgccagggatgccaggccgcagt
gtgagcatcggctacctcctggtgaagcacagccaaacggaccaggagcccatgtgcccc
gtgggcatgaacaagctctggagtgggtacagcctgctgtatttcgagggccaggagaaa
gcgcacaaccaggacctaggactggcaggctcctgcctggcccgcttcagcaccatgcct
ttcctgtactgcaatccgggtgacgtctgctactatgccagccgcaacgacaagtcctac
tggctctccaccacggcccctctacccatgatgcccgtggctgaggaggaaatcaagccc
tacatcagccgctgctctgtgtgcgaggctccggccgtggccattgccgtgcacagccag
gatacctctataccccactgcccagctgggtggcggagtttgtggatcggatattcattc
ctcatgcacactgcagccggggatgaaggcggtggccagtcactggtgtcaccgggcagc
tgtctggaggacttccgtgcaacgccatttatcgagtgtaacgggggccgtggtacctgc
cactacttcgctaacaagtacagcttctggctgaccacaatcccggaacagaacttccag
agcacaccatccgctgacacgctcaaggccggcctcatccgcacgcacatcagccgctgc
caagtgtgcatgaagaatctgtga

KEGG   Mus caroli (Ryukyu mouse): 110300039
Entry
110300039         CDS       T05910                                 

Gene name
Lamc2
Definition
(RefSeq) laminin subunit gamma-2
  KO
K06246  laminin, gamma 2
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04151  PI3K-Akt signaling pathway
mcal04510  Focal adhesion
mcal04512  ECM-receptor interaction
mcal05145  Toxoplasmosis
mcal05146  Amoebiasis
mcal05165  Human papillomavirus infection
mcal05200  Pathways in cancer
mcal05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    110300039 (Lamc2)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    110300039 (Lamc2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110300039 (Lamc2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110300039 (Lamc2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    110300039 (Lamc2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    110300039 (Lamc2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    110300039 (Lamc2)
   05145 Toxoplasmosis
    110300039 (Lamc2)
SSDB
Motif
Pfam: Laminin_EGF Laminin_B Lin-8
Other DBs
NCBI-GeneID: 110300039
NCBI-ProteinID: XP_021025753
Ensembl: MGP_CAROLIEiJ_G0014706
UniProt: A0A6P5Q9J6
LinkDB
Position
1
AA seq 1193 aa
MPALWLSCCLGVALLLPAAQATSRREVCDCNGKSRQCVFDQELQRQTGSGFRCLNCNDNT
AGVHCERCREGFYRQRDRDRCLPCNCHSKGSLSAGCDNSGQCRCKPGVTGQRCDRCQPGF
HMLTDAGCIRDQRQLDSKCDCDPAGISGPCDSGRCVCKPAVTGERCDRCRPGYYHLDRAN
PEGCTQCFCYGHSASCHASADFSVHKITSTFSQDADGWKAVQRNGAPAKLHWSQRHRDVF
SSARRADPVYFVAPAKFLGNQQVSYGQSLSFDYRVDRGGRQPSAYDVILEGAGLKIRAPL
MAPGKTLPCGITKTYTFRLNEHPSSHWSPQLSYFEYRRLLRNLTALLIRATYGEYSTGYI
DNVTLVSARPVSGAPAPWVERCVCPAGYKGQFCQECASGYKRDSARLGPFGACVPCNCQG
GGACDPDTGDCYSGDENPDIECADCPIGFYNDPHDPRSCKPCPCHNGFSCSVMPETEEVV
CNNCPPGVTGARCELCADGFFGDPFGERGPVRPCQRCQCNNNVDPSASGNCDQLTGRCLK
CIYNTAGVYCDQCKAGYFGDPLAPNPADKCRACNCSPMGSEPGECRGDGSCVCKPGFGGL
NCEHAALTSCPACYNQVKIQMDQFTQQLQSLEALVSKAQGGGGGGTVPSGELEGRMQQAE
QALRDILREAQISEGAMRALGFQLAKARSQENNYKTRLDDLKMTAERIRALSSQHQNRVQ
DTSRLISQMRLSLAESEASLQNTNIHSSEHYAGPNGFKSLAQEATRLADSHAESAHAMKQ
LARETEDYSKQALSLARKALSGGGGSGVLDSSVVQGLMGKLEKTKSLTQQLSREGTQADI
EADRSYQHSLRLLDSASQLQGVSDLSFQVEAKRIRQKADSLSNLVTRQTDAFTRVRNNLG
NWEKETRQLLQTGKDRRQTSDQLLSRANLAKNRAQEALSMGNATFYEVENILKNLREFDL
QVEDRKAEAEEAMKRLSSISQKVADASDKTQQAETALGSAAADTQRAKNAAREALEISSE
IEQEIGSLNLEANVTADGALAMEKGLATLKSEMREMEGELARKELEFDTDKDAVQLVITE
AQQADARATSAGVTIQDTLNTLDGILHLIDQPGSVDEKGMMLLEQELFQAKTQINSRLRP
LMSDLEERVRRQRNHLHLLETSIDGILADVKNLENIRDNLPPGCYNTQALEQQ
NT seq 3582 nt   +upstreamnt  +downstreamnt
atgcctgcgctctggctcagctgctgcctcggtgtcgcgctcctgctgcccgcagcccag
gccacctccaggagggaagtctgtgattgcaatgggaagtccaggcaatgcgtctttgat
caggagctccagcgacagacaggcagcgggttccgttgccttaactgcaatgacaataca
gccggggttcactgtgagcggtgcagggaggggttttaccgacagcgagacagagaccgc
tgcctaccctgcaactgccactcaaaaggttccctcagtgctggatgcgacaactctgga
caatgcaggtgtaagccaggtgtgacaggacaaagatgtgaccgatgtcagccaggcttc
catatgctcaccgatgctggatgtattcgagaccagaggcaactagattccaagtgtgac
tgtgacccagctggcatctctggaccctgtgattctggccgatgtgtctgcaaaccagcc
gtcactggagagcgctgtgataggtgccgaccaggctactatcatctggaccgggcaaac
cctgagggctgtacccagtgtttctgctatgggcattcagccagctgccacgcctctgcc
gacttcagtgtccacaaaatcacttcaactttcagtcaggatgcggatggttggaaggcg
gttcagagaaatggggcacctgcaaaactccactggtcacagcgccatcgggacgtgttt
agttctgcccgaagagcagaccccgtctattttgtggcccctgccaaattcctcggtaac
cagcaagtgagttacgggcagagcctgtcttttgactaccgtgtggacagaggaggtaga
cagccatctgcctacgatgtgatcctggaaggtgctggtctaaagatcagggctcctctg
atggcaccgggcaagacacttccctgtgggatcacaaagacttacacattcagactgaat
gaacatccaagcagtcactggagtccccagctgagttatttcgaatatcgaaggttactg
cggaacctcacagccctcctgatccgagctacgtacggagaatatagtacagggtacatt
gataacgtgaccctggtttcagcccgccctgtctctggagccccagccccttgggttgaa
cgttgtgtatgccctgctgggtacaagggacaattctgccaggaatgtgcttctggttac
aaaagagattcggcaagattggggccttttggcgcctgtgttccctgtaactgccaaggg
ggaggggcctgtgatccagacacgggagattgctactctggagacgagaatcctgacatt
gagtgtgctgactgtcccatcggtttctacaatgacccacatgatccccgtagctgcaaa
ccatgtccctgtcacaatgggttcagctgttcagtgatgcctgagacagaggaggtggtg
tgtaacaactgtccccctggggtcacaggtgcccgctgtgagctctgtgctgatggcttc
tttggggatccctttggggaacgtggcccagtgagaccttgtcaacgctgccaatgcaac
aacaacgtggaccccagtgcctctgggaactgtgaccagttgacaggcagatgcttgaaa
tgtatctacaacacagccggtgtctactgtgaccagtgcaaagcaggatactttggagac
ccattggctcccaacccagcagacaagtgtcgagcttgcaactgcagccccatgggctcg
gagcctggagagtgtcgaggtgatggcagctgtgtttgcaagccaggctttggcggcctc
aactgtgagcacgcagccctaaccagttgtcctgcttgctacaatcaagtgaagattcag
atggaccagtttacccagcagctccagagcctggaggccctggtttcaaaggctcagggt
ggtggtggtggtggtacagtccccagtggggagctggaaggcaggatgcagcaggctgag
caggcccttcgagacattctaagagaagctcagatttcagaaggggcaatgagagccctt
ggcttccagctggccaaggcaaggagccaagagaacaactacaagacccgcctggatgac
ctcaagatgactgcggaaaggatccgggccctgagcagtcagcatcagaaccgagttcag
gatacgagcagactcatctctcagatgcgcctgagtctggcagaaagcgaagcttccttg
cagaacactaatatccattcctctgagcactacgcggggccgaatgggtttaaaagtctg
gctcaggaggctacaagattggcagacagccacgctgagtcagctcacgcaatgaagcaa
ctggcaagggaaactgaggactattccaagcaagcactttcgttggcccgcaaggctctg
agtggaggaggcggaagcggcgtcttggacagctccgtggtacaaggtcttatgggaaaa
ttagagaaaaccaagtccctgacccagcagctgtcaagggagggcacccaagccgacatt
gaagctgataggtcttatcagcacagtctccgcctcctggattcagcctctcagcttcag
ggagtcagtgatctgtcctttcaggtggaagcaaagaggatcagacaaaaggctgattct
ctctcaaacctggtgaccagacaaacagatgcattcacacgtgtgcgaaacaatctgggg
aactgggaaaaagaaacacggcagctcttacagactggaaaggataggagacagacttca
gatcagctgctttcccgtgccaaccttgctaaaaacagagcccaagaagcgctaagtatg
ggcaatgccactttttatgaagttgagaacatcctgaagaacctccgagagtttgatctg
caggttgaagacagaaaagcagaggctgaagaggccatgaagagactctcctctattagc
cagaaggttgcagatgccagtgacaagacccagcaagcagaaacggccctggggagcgcc
gctgctgacacccaacgggcaaagaacgcagctagggaggccctggagatcagcagtgag
atagagcaggagatagggagtctgaacttggaagccaatgtgacagcagatggggccttg
gccatggagaagggactggccactctgaagagcgagatgagagagatggagggggagctg
gccaggaaggagctggagtttgacacggataaggacgcggtgcagctggtgattactgaa
gcccagcaagctgatgccagagccacgagtgctggagttaccatccaagacacgctcaac
acattggacggcatcctacacctcatagaccagcctggcagtgtggatgaaaaagggatg
atgctattagaacaagagcttttccaagccaagacccagatcaacagtcgacttcggccc
ttgatgtctgacctggaggagagggtgcgtcggcagaggaaccacctccatctgctggag
accagcatagatggaattctagctgatgtgaagaacctagagaacattcgagacaacctg
cccccaggctgctacaatactcaagctcttgagcaacagtga

KEGG   Mus caroli (Ryukyu mouse): 110301253
Entry
110301253         CDS       T05910                                 

Gene name
Lamb2
Definition
(RefSeq) laminin subunit beta-2
  KO
K06243  laminin, beta 2
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04151  PI3K-Akt signaling pathway
mcal04510  Focal adhesion
mcal04512  ECM-receptor interaction
mcal05145  Toxoplasmosis
mcal05146  Amoebiasis
mcal05165  Human papillomavirus infection
mcal05200  Pathways in cancer
mcal05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    110301253 (Lamb2)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    110301253 (Lamb2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110301253 (Lamb2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110301253 (Lamb2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    110301253 (Lamb2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    110301253 (Lamb2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    110301253 (Lamb2)
   05145 Toxoplasmosis
    110301253 (Lamb2)
SSDB
Motif
Pfam: Laminin_EGF Laminin_N F5_F8_type_C
Other DBs
NCBI-GeneID: 110301253
NCBI-ProteinID: XP_021027291
Ensembl: MGP_CAROLIEiJ_G0032691
UniProt: A0A6P7RKU6
LinkDB
Position
9
AA seq 1799 aa
MEWASGEPGRGRQGQPVPWELRLGLLLSVLAATLAQAPSLDVPGCSRGSCYPATGDLLVG
RADRLTASSTCGLHSPQPYCIVSHLQDEKKCFLCDSRRPFSARDNPNSHRIQNVVTSFAP
QRRTAWWQSENGVPMVTIQLDLEAEFHFTHLIMTFKTFRPAAMLVERSADFGRTWHVYRY
FSYDCGADFPGIPLAPPRRWDDVVCESRYSEIEPSTEGEVIYRVLDPAIPIPDPYSSRIQ
NLLKITNLRVNLTRLHTLGDNLLDPRREIREKYYYALYELVIRGNCFCYGHASQCAPAPG
APAHAEGMVHGACICKHNTRGLNCEQCQDFYQDLPWHPAEDGHTHACRKCECNGHTHSCH
FDMAVYLASGNVSGGVCDGCQHNTAGRQCEFCRPFFYRDPTKDMRDPAVCRPCDCDPMGS
QDGGRCDSHDDPVLGLVSGQCRCKEHVVGTRCQQCRDGFFGLSASDPRGCQRCQCNSRGT
VPGGSPCDSSSGTCFCKRLVTGHGCDRCLPGHWGLSHDLLGCRPCDCDVGGALDPQCDEA
TGQCRCRQHMIGRRCEQVQPGYFRPFLDHLTWEAEAAQGQGLEVVERLVTNRETPSWTGP
GFVRLREGQEVEFLVTSLPRAMDYDLLLRWEPQVPEQWAELELLVQRPGPVSAHSPCGHV
LPKDDRIQGMLHPNTRFLVFPRPVCLEPGISYKLKLKLIGTGGRVQPETSYSGLLIDSLV
LQPHVLVLEMFSGGDAAALERRTTFERYRCHEEGLMPSKAPLSETCAPLLISVSSLIYNG
ALPCQCDPQGSLSSECNPHGGQCRCKPGVVGRRCDVCATGYYGFGPAGCQACQCSPDGAL
SALCEGTSGQCPCRPGAFGLRCDHCQRGQWGFPNCRPCVCNGRADECDTHTGACLGCRDY
TGGEHCERCIAGFHGDPRLPYGGQCRPCPCPEGPGSQRHFATSCHRDGYSQQIVCQCREG
YTGLRCEACAPGHFGDPSKPGGRCQLCECSGNIDPTDPDACDPHTGQCLRCLHNTEGPHC
GYCKPGFHGQAARQSCHRCTCNLLGTDPRRCPSTDLCHCDPSTGQCPCLPHVQGLNCDHC
APNFWNFTSGRGCQPCACHPSRARGPTCNEFTGQCHCHAGFGGRTCSECQELYWGDPGLQ
CRACDCDPRGIDKPQCHRSTGHCSCRPGVSGVRCDQCARGFSGVFPACHPCHACFGDWDR
VVQDLAARTRRLEQWAQELQQTGVLGAFESSFLNMQGKLGMVQAIISARNASAASTAKLV
EATEGLRHEIGKTTERLTQLEAELTAVQDENFNANHALSGLERDGLALNLTLRQLDQHLE
ILKHSNFLGAYDSIRHAHSQSTEAERRANASTFAVPSPVSNSADTRRRTEVLMGAQKENF
NRQHLANQQALGRLSAHAHTLSLTGINELVCGAPGDAPCATSPCGGAGCRDEDGQPRCGG
LGCSGAAATADLALGRARHTQAELQRALVEGGGILSRVSETRRQAEEAQQRAQAALDKAN
ASRGQVEQANQELRELIQNVKDFLSQEGADPDSIEMVATRVLDISIPASPEQIQRLASEI
AERVRSLADVDTILAHTMGDVRRAEQLLQDAQRARSRAEGERQKAETVQSALEEAQRAQG
AAQGAIRGAVVDTQNTEQTLQRVQERMAGAEKSLNSAGERARQLDALLEALKLKRAGNSL
AASTAEETAGSAQSRAREAEKQLREQVGDQYQTVRALAERKAEGVLAAQARAEQLRDEAR
VLLQAAQDKLQRLQELEGTYEENERALEGKAAQLDGLEARMRSVLQAINLQVQIYNTCQ
NT seq 5400 nt   +upstreamnt  +downstreamnt
atggagtgggcctcaggagaaccagggaggggcaggcagggacagcctgtgccatgggaa
cttcgcttgggcctacttctaagtgtgctggctgccacattggcccaggccccatccttg
gatgtacctggctgttctcgaggaagctgctatccagccaccggtgacctgttggtgggc
cgtgcagacagactgacggcctcatccacgtgtggcttgcatagccctcaaccctactgt
attgtcagtcacctgcaggacgaaaagaagtgtttcctgtgtgactcccgacgtcccttc
tctgctcgagacaacccaaatagtcatcggatccagaatgtagtcaccagctttgcgcca
caacgccggacggcctggtggcaatcggagaacggtgttccaatggtcaccatccaactg
gacctggaagctgagttccatttcacccacctcattatgacgttcaagacgttccggcct
gctgctatgctggtggagcgttctgcagactttggccgcacctggcacgtgtaccgatat
ttttcctatgactgcggggctgacttcccgggaatcccactggccccgccacgtcgctgg
gatgatgtagtgtgtgagtcccgctactcagaaattgagccgtctacggaaggcgaggtc
atctatcgtgtgctggaccctgctattcctatcccagacccctacagctcacggattcaa
aacctgttgaagatcaccaacctacgagtgaacttaacccggcttcacacactgggagac
aacttgcttgacccacggcgggagatccgggaaaaatactattatgctctctatgaactt
gtcatccgtggcaactgcttctgctatggccacgcctcacagtgcgcgcctgcaccaggg
gcgccggcccatgctgagggcatggtacacggagcctgtatctgcaagcacaatactcgt
ggactcaactgtgagcaatgtcaggatttctatcaggaccttccctggcaccctgcagag
gacggccatactcatgcctgtcggaagtgtgagtgcaacgggcatactcatagctgccac
tttgacatggctgtctacctggcatctggaaatgtaagtggaggcgtatgcgatgggtgt
cagcacaacacagctgggcgccaatgcgagttctgccggcccttcttctaccgtgacccc
accaaggacatgcgggacccagctgtgtgccgtccttgtgactgtgaccctatgggttct
caagatggtggtcgctgtgattctcatgatgaccctgtgctaggactggtctcaggccag
tgtcgctgcaaagaacacgtggttggcactcgctgccagcaatgccgtgatggcttcttt
ggacttagtgccagtgaccctcgagggtgccagcgttgccagtgtaattcacggggcaca
gtgcctgggggctccccttgtgactccagtagtggaacctgtttctgcaagcgtctggtg
actggtcatggctgtgaccgctgtctgcctggccactggggcctgagccacgacctgctg
ggctgccgtccctgtgactgtgatgtgggcggtgccttggatcctcagtgtgatgaggcc
acgggtcagtgccgctgccgccaacacatgattggacggcgctgtgaacaagtgcagcct
ggttacttccggccttttctggaccatttaacctgggaggctgaggctgcccaagggcag
gggcttgaggtggtagagcgtctggtgaccaaccgagagactccgtcctggactggccca
ggctttgtgcggctgcgagaaggtcaggaagtggagttcctggtgacctctttgcctagg
gccatggactatgacctgctactgcgctgggagccccaggtccctgagcaatgggcagag
ctggaactgttggtgcagcgtccggggcctgtgtctgctcacagtccatgcgggcatgtg
ctgcctaaggatgaccgcattcagggaatgcttcacccaaacaccaggtttttggtgttt
cccagacctgtctgccttgagcctggcatctcctacaagctgaagctgaaactgattgga
acagggggacgagtccagcctgaaacctcctactctggattactcattgactcgctggtc
ctgcagccccatgtcttggtgctagagatgtttagtgggggtgatgctgctgctctggag
cgccgtaccacctttgaacgctaccgctgccatgaggaaggtctgatgcccagcaaggcc
cctctatctgagacctgtgcccccctcctcatcagcgtgtcctccttgatctacaatggc
gccttgccatgtcagtgtgaccctcaaggctcactgagttctgaatgcaatcctcacggc
ggccagtgccggtgcaaacctggagtggttggacgccgctgtgatgtctgtgctactggc
tactatggctttggccctgcaggctgtcaagcttgccagtgtagtcctgatggagcactc
agtgccctctgtgaagggactagtggacagtgcccctgccgacctggtgcctttggcctt
cgctgtgaccactgtcaacgtggccagtggggattccctaattgccggccgtgtgtttgc
aatgggcgtgccgatgagtgtgatacccacacaggcgcttgcctgggctgccgtgattac
acagggggcgagcactgtgaaaggtgcattgctggttttcatggggacccacggctgcca
tatgggggccagtgccggccttgtccctgccctgaaggccccgggagccagcgacacttt
gctacttcttgccaccgggatggatattcccagcaaattgtgtgccagtgtcgagaaggc
tacacagggcttcggtgtgaagcttgtgcccctgggcactttggggacccatcaaagcca
ggtggcaggtgccaactgtgtgagtgcagtggaaacattgatcccacggaccctgatgcc
tgtgatccccacacggggcaatgcttgcgttgtttacacaacacagaggggccccactgt
ggctattgcaagcctggcttccacgggcaagctgcccggcagagctgtcaccgctgtacc
tgcaaccttctgggcacagatcccaggcggtgcccatctaccgacctgtgccattgtgac
ccaagcactgggcagtgcccatgccttccccatgtccaaggcctcaactgtgaccattgt
gcccccaacttttggaacttcaccagtggccgtggctgccagccttgtgcttgtcaccca
agccgggccagaggccctacctgcaatgagttcacagggcagtgtcactgtcatgctggc
tttggtgggaggacttgttctgagtgccaagagctctactggggagaccctggtcttcag
tgccgtgcctgtgactgtgatcctagaggaatagacaaacctcaatgtcaccgttccacg
ggccactgtagctgccgcccaggcgtgtctggtgtgcgctgtgaccagtgtgctcgtggc
ttctcaggggtttttcctgcttgtcacccctgccacgcatgctttggagactgggatcgt
gtggtacaggacctggctgctcggacgcggcgcctggagcagtgggctcaggagttgcag
caaacgggagtgctgggtgcttttgagagcagctttttgaacatgcaggggaagctgggc
atggtgcaggccattataagtgcccgcaatgcctcagccgcctctacggcgaagcttgta
gaggccacagagggactgcgtcatgaaattgggaagaccaccgagcgcctgactcagttg
gaagcagagctaacagctgtgcaggatgagaacttcaatgccaaccatgcactcagtggt
ctggagagagacgggcttgcgcttaatctcactctgaggcagctggatcagcatctggag
atcctcaaacattcaaatttcttaggtgcctatgacagcatccgacatgcccacagccag
tccacagaagcagagcgccgtgccaacgcctccacctttgcagtacccagccctgtgagc
aactcagcagatacccggcgtcggacagaagtgctaatgggtgcccaaaaagaaaacttc
aaccgccaacacttggccaaccagcaggcactgggacggctctctgcacatgcccacacc
ctgagcctgacgggcataaatgagttggtgtgtggggccccaggggacgcaccctgtgcc
accagcccttgtgggggtgccggatgtcgggatgaagatgggcagccccgttgtggtggc
ctcggttgcagtggggcagcagccacggcagatctagcgctgggccgggctcggcacacg
caggcagagctgcagcgggcactggtagaaggtggaggcatcctcagccgggtgtctgag
actcgtcggcaggcagaggaggcacagcagcgagcacaggcagccctggacaaggctaat
gcttccaggggccaggtggaacaggccaatcaggagcttcgagaacttatccagaatgtg
aaagacttcctcagccaggagggagctgatcctgacagtattgaaatggtagcgactcgg
gtgctagacatctccatcccggcctcacctgagcagatccagcgcctagcaagtgagatt
gcagaacgcgtccgaagcctggccgatgtggacacaatcctggcccataccatgggtgac
gtgcgtcgggctgaacagctactgcaagatgcgcagcgggcacggagccgggccgagggt
gagagacagaaggcagagacagtccaatcggcactggaggaggctcagagggcacaagga
gctgctcagggtgccatccggggagcagtggttgacacacaaaacacagagcagaccctg
cagcgggtccaggagaggatggcaggtgctgagaagtctctgaactctgctggtgagcgg
gctcggcaattagatgccctcctggaggccctgaaactgaaacgggcaggaaatagcttg
gcagcatctacagcagaagaaacagctggcagtgcccagagccgtgccagggaggctgag
aaacaactacgggaacaagtaggtgaccaataccaaacagtgagggcgttggcagagcgg
aaggctgaaggtgttctggctgcacaagccagggcagaacaactgcgggatgaggctcgg
gtcctgttgcaggcagctcaggacaagctgcagcggctacaggagctggagggcacatat
gaggagaacgagcgtgcactggagggcaaagcggcccagctggatgggctggaagccagg
atgcgcagtgtgctccaggccatcaacctgcaggtccagatctacaacacctgccagtga

KEGG   Mus caroli (Ryukyu mouse): 110302840
Entry
110302840         CDS       T05910                                 

Gene name
Lama2
Definition
(RefSeq) laminin subunit alpha-2
  KO
K05637  laminin, alpha 1/2
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04151  PI3K-Akt signaling pathway
mcal04510  Focal adhesion
mcal04512  ECM-receptor interaction
mcal05145  Toxoplasmosis
mcal05146  Amoebiasis
mcal05165  Human papillomavirus infection
mcal05200  Pathways in cancer
mcal05222  Small cell lung cancer
mcal05410  Hypertrophic cardiomyopathy
mcal05412  Arrhythmogenic right ventricular cardiomyopathy
mcal05414  Dilated cardiomyopathy
mcal05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    110302840 (Lama2)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    110302840 (Lama2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110302840 (Lama2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110302840 (Lama2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    110302840 (Lama2)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    110302840 (Lama2)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    110302840 (Lama2)
   05414 Dilated cardiomyopathy
    110302840 (Lama2)
   05416 Viral myocarditis
    110302840 (Lama2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    110302840 (Lama2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    110302840 (Lama2)
   05145 Toxoplasmosis
    110302840 (Lama2)
SSDB
Motif
Pfam: Laminin_G_1 Laminin_EGF Laminin_G_2 Laminin_I Laminin_N Laminin_B Laminin_II Laminin_G_3 DUF948 Ribosomal_S15 Arfaptin
Other DBs
NCBI-GeneID: 110302840
NCBI-ProteinID: XP_021029255
Ensembl: MGP_CAROLIEiJ_G0015201
UniProt: A0A6P5QG00
LinkDB
Position
10
AA seq 3118 aa
MPAAAAGILLVLLLGTLEGSQTQRRQSQAHQQRGLFPAVLNLASNALITTNATCGEKGPE
MYCKLVEHVPGQPVRNPQCRICNQNSSNLYQRHPITNAIDGKNTWWQSPSIKNGVEYHYV
TITLDLQQVFQIAYVIVKAANSPRPGNWILERSLDDVEYKPWQYHAVTDTECLTLYNIYP
RTGPPSYAKDDEVICTSFYSKIHPLENGEIHISLINGRPSADDPSPELLEFTSARYIRLR
FQRIRTLNADLMMFAHKDPREIDPIVTRRYYYSVKDISVGGMCICYGHARACPLDPATNK
SRCECEHNTCGESCDRCCPGFHQKPWRAGTFLTKSECEACNCHGKAEECYYDETVASRNL
SLNIHGKYIGGGVCINCTHNTAGINCETCVDGFFRPKGVSPNYPRPCQPCHCDSTGSLSE
VCVKDEKYAQRGLKPGSCHCKTGFGGMNCDRCVRGYRGYPDCQPCNCSGLGSTNEDPCLG
PCSCKENVEGEDCSRCKSGFFNLQEDNQKGCEECFCSGVSNRCQSSYWTYGNIQDMHGWY
LTDLPGRIRMVPQLDNPDSPQQISISNSEARKSLPDGYYWSAPPPYLGNRLAAVGGHLSF
TISYGLEEEEDDTEKILQLMIIFEGNNLRISTAYKEVYLEPSEEHVEEVPLKEEAFTIHG
TNLPVTRKDFMIVLTNLERVLMQITYNLGMDAIFRLSSVNLESAVPYPTDRRIATDVEVC
QCPPGYSGSSCETCWPRYRRVNGTIFGGICEPCQCFAHAEACDDITGECLNCKDHTGGPY
CNECLPGYYGDPTRGTPEDCQPCACPLNIPSNNFSPTCHLDRSLGLICDECPIGYTGPRC
ERCAEGYFGQPSVPGGSCQPCQCNDNLDYSIPGSCDSLSGSCLICKPGTTGRYCELCADG
YFGDAVNAKNCQPCRCNINGSFSEICHTRTGQCECRPNVQGRHCDECKPETFGLQLGRGC
LPCNCNSFGSKSFDCEASGQCWCQPGVAGKKCDRCAHGYFNFQEGGCIACDCSHLGNNCD
PKTGQCICPPNTTGEKCSECLPNTWGHSIVTGCKVCNCSTVGSLASQCNVNTGQCSCHPK
FSGMKCSECSRGHWNYPLCTLCDCFLPGTDATTCDSETRKCSCSDQTGQCSCKVNVEGVH
CDRCRPGKFGLDAKNPLGCSSCYCFGVTSQCSEAKGLIRTWVTLSDEQTILPLVDEALQH
TTTKGIAFQKPEIVAKMDEVRQDLHLEPFYWKLPQQFEGKKLMAYGGKLKYAIYFEARDE
TGFATYKPQVIIRGGTPTHARIITRYMAAPLIGQLTRHEIEMTEKEWKYYGDDPRISRTV
TREDFLDILYDIHYILIKATYGNVVRQSRISEISMEVAEPGHVLAASPPAHLIERCDCPP
GYSGLSCETCAPGFYRLRSEPGGRTPGPTLGTCVPCQCNEHSSQCDPETSVCQNCQHHTA
GDFCERCALGYYGIVKGLPNDCQPCACPLISPSNNFSPSCVLEGLEDYRCTACPRGYEGQ
YCERCAPGYSGSPSSPGGSCQECECDPYGSLPVPCDRVTGLCTCRPGATGRKCDGCEHWH
AREGAECVFCGDECTGLLLGDLARLEQMTLNINLTGPLPAPYKILYGLENTTQELKHLLS
PQQAPERLIQLAEGNVNTLVMETNELLNRATKVTADGEQTGQDAERTNSRAESLEEFIKG
LVQDAEAINEKAVKLNETLGNQDKTAERNLQELQKEIDRMLKELRSKDLQTQKEVAEDEL
VAAEGLLKRVNKLFGEPRAQNEEMEKDLQQKLAEYKNKLDDAWDLLREATDKTRDANRLS
AGNQKNMTILETKKEALEGSKRQIENTLKEGNDILDEANRLLGEINSVIDYVDDIKTKLP
PMSEELSDKIDDLAQEIKDRRLAEKVFQAESHAAQLNDSSAVLDGILDEAKNISFNATAA
FRAYSNIKDYIDEAEKVAREAKELAQGATKLATSPQGLLKEDAKGSLQKSFRILNEAKKL
ANDVKGNHNDLNDLKTRLETADLRNSGLLGALNDTMDKLSAITNDTAAKLQAVKEKAREA
NDTAKAVLAQVKDLHQNLDGLKQNYNKLADSVAKTNTVVKDPSKNKIIADAGTSVRNLEQ
EADRLIDKLKPIKELEDNLKKNISEIKELINQARKQANSIKVSVSSGGDCVRTYRPEIKK
GSYNNIVVHVKTAVADNLLFYLGSAKFIDFLAIEMRKGKVSFLWDVGSGVGRVEYPDLTI
DDSYWYRIEASRTGRNGSISVRALDGPKASMLPSTYHSVSPPGYTILDVDANAMLFVGGL
TGKIKKADAVRVTTFTGCMGETYFDNKPIGLWNFREREGDCKGCTVSPQVEDSEGTIQFD
GEGYALVSRPIRWYPNISTVMFKFRTFSSSALLMYLATRDLKDFMSVELSDGHVKVSYDL
GSGMTSVVSNQNHNDGKWKAFTLSRIQKQANISIVDIDSNQEENVATSSSGNNFGLDLKA
DDKIYFGGLPTLRNLSMKARPEVNVKKYSGCLKDIEISRTPYNILSSPDYVGVTKGCSLE
NVYTVSFPKPGFVELAAVSLDVGTEINLSFSTRNESGIILLGSGGTLTPPRRKRRQTTQA
YYAIFLNKGRLEVHLSSGTRTMRKIVIKPEPNLFHDGREHSVHVERTRGIFTVQIDEDRR
HMQNLTEEQPIEVKKLFVGGAPPEFQPSQLRNIPAFQGCVWNLVINSIPMDFAQPIAFKN
ADIGRCAYQKPREDESEAVPAEVIVEPQPVPTPAFPFPAPTVVHGPCVAESEPALLTGSK
QFGLSRNSHIAIAFDDTKVKNRLTIELEVRTEAESGLLFYMARINHADFATVQLRNGFPY
FSYDLGSGDTNTMIPTKINDGQWHKIKIVRVKQEGILYVDDASSQTISPKKADILDVVGI
LYVGGLPINYTTRRIGPVTYSLDGCIRNLQMEQAPVNLDQPTSSFHIGTCFANAESGTYF
DGTGFAKAVGGFKVGLDLLVEFEFRTTRPTGVLLGVSSQKMDGMGIEMIDEKLLFHVDNG
AGRFTAVYDAGIPGHMCNGQWHKVTAKKIKNRLELVVDGNQVNAQSPNSASTSADTNDPV
FVGGFPGGLNQFGLTTNIRFRGCIRSLKLTKGTGKPLEVNFAKALELRGVQPVSCPTT
NT seq 9357 nt   +upstreamnt  +downstreamnt
atgcctgcggcggccgccgggatcctcttggtcctgctcttggggacgcttgaaggctcc
cagactcagcggcgacagtcccaagcgcatcaacagagaggtttatttcctgctgtcctg
aatcttgcttcgaatgcactcatcacaaccaatgctacatgtggggaaaaaggacccgag
atgtactgcaagttggtggaacatgtccccgggcagcctgtgaggaaccctcagtgccga
atctgcaatcagaacagcagcaatctataccagaggcacccgatcacaaatgctattgat
ggcaagaacacttggtggcagagtcccagtatcaagaatggagtggaataccattatgtg
acaattactctggatttacagcaggtgttccagattgcctacgtaattgtgaaggcagcc
aattcccctcggcctggaaactggattttggaacgttccctggatgacgtggagtacaaa
ccatggcagtatcatgcggtgacagacacggagtgcctgaccctctacaatatctatccc
cgcactggaccaccatcctatgccaaagatgatgaggtcatctgcacttcattctattcc
aagatccaccctttagaaaatggagagattcacatttctttgatcaatgggagaccaagt
gctgacgatccctcccctgaactcctggaattcacctctgctcgctacattcgcctgaga
tttcagaggatccgcaccttgaatgcagacttgatgatgtttgctcacaaagaccccaga
gaaatcgatcccattgtcacacgaagatattactattctgtcaaggatatttcggttggc
gggatgtgcatctgttatggtcatgcccgggcttgtccacttgaccctgcaacaaataaa
tcacgctgtgagtgtgaacataacacctgtggggaaagctgtgacaggtgctgtccagga
ttccatcagaagccttggagagctggaaccttcctcaccaagtctgaatgtgaagcatgc
aattgtcatggaaaagctgaggaatgctattatgatgaaactgttgctagcagaaatcta
agtttaaatatacatgggaagtacatcggagggggtgtgtgcatcaactgcacacataac
acggctgggataaattgtgagacgtgtgttgatggattcttcagaccaaaaggggtgtca
ccaaattatccaagaccatgccagccatgtcactgtgattcaactggctcccttagtgaa
gtctgtgtcaaagatgagaaatacgcccagcgagggttgaaacctggatcctgtcactgc
aaaactggctttggaggcatgaactgtgatcgctgtgtcaggggttaccgtggttaccca
gactgccaaccctgcaactgtagtggcttggggagcacaaatgaggacccttgccttggg
ccctgtagctgtaaggagaatgttgaaggtgaagactgtagccgttgcaaatctggtttc
ttcaacttgcaagaagataatcagaaaggctgtgaggagtgtttctgttcaggggtatca
aacagatgtcagagttcctactggacctacgggaatattcaagacatgcatggttggtat
ctcacagacctccctggccgcattcggatggttccccagcttgataaccctgactcacct
cagcagatcagcatcagtaactctgaggcccggaaatccctgccagatggttactactgg
agtgcaccacctccatatctgggaaacagacttgcagctgttggaggacacttgtcattt
accatctcatatggcctcgaagaagaggaagatgatacagaaaaaatccttcagctgatg
attatctttgagggaaataacttaagaatcagcacagcgtataaggaggtgtacttagag
ccatctgaagaacacgttgaggaggtgccactcaaagaagaggcctttaccatacatgga
acaaatttgccagtcactagaaaagatttcatgattgttctcacaaatttggagagagtc
cttatgcaaatcacatacaacttagggatggacgccatcttcagactgagttctgtcaat
cttgaatctgctgtcccttatcctactgatagacgtatcgcaactgatgtggaagtttgc
cagtgtccacccgggtacagtggcagctcttgtgaaacatgttggcctaggtaccgaaga
gttaacggcactatttttggtggcatttgtgaaccatgtcagtgctttgctcatgcagaa
gcatgtgatgacatcacaggagaatgtctgaactgtaaggatcacacaggtgggccatac
tgcaatgaatgtctccctggttactatggtgaccctactcgaggaacccctgaagactgt
cagccctgtgcctgtccactcaatatcccatcaaataactttagtccaacatgccattta
gaccggagtctgggattgatctgtgatgagtgtcctattgggtacacaggaccacgctgt
gagaggtgtgcagaaggctattttggacaaccttccgtacctggaggatcatgtcagcca
tgccaatgcaatgacaaccttgactactccatccctggcagctgtgacagcctgtctggc
tcctgtctgatttgtaagccgggtacaacaggccggtactgtgagctctgtgctgatggg
tattttggagacgcggttaatgcaaagaactgtcaaccatgccgttgtaacatcaatggc
tccttctcagagatttgtcacactagaactgggcaatgtgagtgcagacccaatgtgcag
gggcggcactgtgacgagtgtaagcctgaaacctttggcctgcaactgggaaggggttgt
ctgccctgcaactgcaattcttttgggtcgaagtcgtttgactgtgaagcgagtgggcag
tgctggtgccagcctggagtagcagggaagaaatgtgaccgttgtgcccatggctacttc
aacttccaagaaggaggctgcatagcttgtgactgttctcatctgggcaacaactgtgac
ccaaaaactggtcaatgcatttgcccacccaataccactggagaaaagtgttctgagtgt
cttcccaacacctggggccacagcattgtcaccggctgtaaggtttgtaactgcagcact
gtggggtccttggcttctcagtgcaatgtaaacacgggccagtgcagctgtcatccaaaa
ttctctggtatgaaatgctcagagtgcagccgaggtcactggaactatcctctctgcact
ctatgtgactgcttccttccagggacagatgccacgacttgtgattcagagactaggaaa
tgctcctgtagtgatcaaactggacagtgcagctgtaaggtgaatgtggaaggcgtccac
tgtgacaggtgccggcctggcaaatttggactagatgccaagaatccacttggctgcagc
agctgctactgctttggagttactagtcaatgctctgaagcaaaaggactgattcgtacg
tgggtgactttgagtgatgagcagaccattctacctctggtggatgaggccctgcagcac
acgactaccaaaggcattgctttccagaaaccagagattgttgcaaagatggatgaagtc
aggcaagatctccatttggaacctttttactggaaactcccacaacaatttgaagggaaa
aagttgatggcttatgggggcaaactcaagtatgccatctattttgaggctcgggatgag
acaggctttgccacatataaacctcaagttatcattcgaggtggaactcctactcatgct
agaattattaccagatacatggctgcccctctcattggccagttgacacggcatgaaata
gaaatgacagagaaagaatggaaatattatggtgatgatccgcgaatcagtagaactgtg
acccgtgaagacttcttggatatactatatgatattcactatatccttatcaaggctact
tatggaaatgttgtgagacaaagccgcatttctgaaatctccatggaagtagccgaacca
ggacatgtattagcagcgagcccgccagcacacttgatagaaagatgcgactgccctcct
ggctattctggcttgtcttgtgagacgtgtgcaccaggattttatcgactgcgttctgaa
ccaggtggccgcactcctggaccaaccttaggaacctgtgttccctgtcaatgtaatgaa
cacagcagccagtgtgatcctgagacctcagtatgccagaattgtcagcatcacactgct
ggtgacttctgtgagcgctgtgcccttggctactatggaattgtcaagggattgccaaat
gactgtcaaccatgcgcttgtcctctgatttcgcccagcaacaatttcagcccctcttgt
gtattggaaggtctggaagattaccgttgcacagcctgcccaaggggatatgaaggacag
tactgtgaaaggtgtgccccaggctacagtggcagcccaagcagccccggaggctcctgc
caagaatgtgagtgtgacccttatggctccctaccggttccctgtgaccgggtcacggga
ctctgcacgtgccgccctggagccacaggaaggaagtgtgatggctgcgagcactggcat
gcacgcgagggtgcagagtgtgtcttttgtggagacgagtgtacaggacttcttcttggt
gacctggctcgtctagagcagatgaccttgaacatcaacctcacgggcccactgcctgct
ccatataaaattctgtatggtcttgaaaatacaactcaggaactcaagcacctgctatca
ccgcaacaggcaccagagaggctcattcagttggcagagggcaatgtgaacacacttgtg
atggaaacgaatgagcttctaaacagagcaaccaaagtgacagcagatggtgagcaaaca
ggacaagatgctgagaggaccaactccagagcagaatccttggaagaattcattaaaggg
cttgtccaggatgctgaagccataaatgaaaaagctgtaaaactaaatgaaaccttagga
aatcaagataagacagcagagagaaacttgcaagagcttcagaaggagatcgaccggatg
ctgaaggaactgagaagtaaagatcttcaaacacagaaggaagttgctgaggatgagctc
gtggcagcagaaggccttctgaagagagtaaacaagctgtttggagagcctagagcccag
aatgaagaaatggaaaaggatctccagcagaaactggcagagtacaagaacaaacttgat
gatgcttgggatctattgagagaagccactgataaaactcgtgatgctaatcgcttgtct
gctggcaatcaaaaaaacatgaccatattggagacaaagaaggaggctcttgaaggtagc
aaacggcaaatagagaacactttaaaggagggcaatgacatccttgatgaagccaatcga
ctcttaggcgaaatcaactcagtcatagattatgtcgatgacattaaaactaagttgcca
ccaatgtctgaggagctgagtgacaaaatagatgacctcgcccaggaaataaaggacaga
aggcttgctgagaaggtgttccaggctgagagccacgctgctcagctgaatgactcgtct
gctgtgcttgatggaatcctggatgaagctaagaacatctctttcaatgccacggcagcc
ttcagagcttacagtaatattaaagactatattgatgaagctgagaaagtggccagagaa
gccaaagagcttgcccaaggggctacaaaactggcaacaagtcctcagggcttattaaaa
gaagatgccaaaggctcccttcagaaaagcttcaggatcctcaatgaagccaagaagcta
gcaaatgatgtgaaaggaaatcacaatgacctaaatgacctgaaaaccaggttagaaact
gctgaccttagaaacagtggactcctaggagctctaaatgacaccatggacaagttatca
gccattacaaatgacacggctgctaaactgcaggctgtcaaagagaaagccagagaagcc
aatgacacagcaaaagctgtcctggcccaggttaaggacttgcatcagaacctagatggc
ctgaagcaaaactacaataaactagcagacagcgtggccaaaacgaacactgtggtgaaa
gatccttccaaaaacaaaatcattgcagatgcaggtacttctgtgagaaatctagaacag
gaagctgaccggctaatcgacaaactcaagcccatcaaggaacttgaggacaacctaaag
aaaaacatttctgaaataaaggaactgatcaaccaagctcggaaacaagctaattctatc
aaagtatctgtttcttcgggaggtgactgtgttcgaacatacaggccagaaatcaagaaa
ggaagctacaataacatcgttgtccatgtcaagaccgctgttgccgacaacctccttttt
taccttggaagtgccaaatttattgactttcttgctatagaaatgcgtaaaggcaaagtc
agcttcctctgggatgttggctctggagttggccgagtagagtatccagacttgaccatc
gatgactcctattggtaccgtattgaagcatcaagaacgggaagaaatggatctatttct
gtgagagctttagatggacccaaagccagtatgttacccagcacctaccattcagtgtct
cctcccgggtatactatcctagatgtggacgcaaatgcaatgctgtttgttggtggcctg
accggaaaaataaagaaggctgatgctgtacgggtgactaccttcaccggctgtatggga
gaaacatactttgacaacaaacctataggtttatggaatttccgggagagagaaggcgac
tgtaaaggatgtactgtcagcccacaagtggaagacagtgaggggactattcagtttgat
ggtgaaggctacgcattagtgagccgccccatccgctggtaccccaacatctccacagtc
atgttcaagttccggacattttcatcaagtgctctcctgatgtatcttgccacacgagac
ctgaaagatttcatgagtgtagagctcagtgatggacatgtgaaagtcagctatgacctg
ggctcaggaatgacttccgttgtcagcaatcaaaaccataatgatgggaaatggaaagca
ttcacgctgtcgcggattcagaaacaagccaacatatccattgtagacatcgattctaac
caggaggagaatgtagctacttcatcttctggaaacaactttggtcttgacttgaaagca
gatgacaaaatatattttggtggcctgccaactctgagaaacttgagtatgaaagcaagg
ccagaagtcaatgtgaagaaatactcaggctgcctcaaagatattgaaatttcaagaaca
ccttacaatatactcagcagccctgattacgttggtgtgaccaaaggctgttcactggag
aatgtttatacagttagtttccccaagcctggttttgtggagcttgccgctgtgtctctt
gatgttggaacagaaatcaatctgtcctttagtaccaggaacgagtctgggatcattctc
ttaggaagtggaggaacactcacaccacccaggagaaaacggagacaaaccacacaggct
tattatgccatattcctcaacaagggccgcctggaagtgcatctctcctcggggacacgg
acaatgaggaaaattgtcatcaaaccggagccaaatttgtttcatgatgggagagaacat
tctgtccatgtagaaagaaccagaggcatcttcactgttcaaattgatgaagacagaaga
catatgcaaaacctgacagaggaacagcccatcgaagtgaaaaagctctttgtcgggggt
gctcctcctgaatttcagccctcccaactcaggaatattccggcctttcaaggctgtgtg
tggaaccttgttattaactccatccccatggactttgcgcagcctatagccttcaaaaat
gccgacattggccgctgtgcctatcaaaagccccgggaagatgagagtgaagcggttcca
gctgaagttattgtcgagcctcagcccgtgcctacccctgccttccctttcccggccccc
accgtggtgcatggcccttgtgttgcagaatcagaaccagctcttctgacagggagcaag
cagtttgggctttccagaaacagccatattgctattgcttttgatgacaccaaagttaaa
aaccgcctcaccattgagctggaggtacgaactgaagctgaatcaggcttgctcttctac
atggctcggatcaatcatgctgattttgctactgttcagctgaggaatggcttcccctac
ttcagttatgatttggggagtggggacacaaacaccatgatccccacaaaaatcaacgat
ggtcagtggcacaagattaagattgtgagagtgaagcaggagggaattctttatgtggat
gatgcctccagccaaaccatcagtcccaagaaagccgacatcctggatgtggtggggatt
ctgtatgtcggtggattgccgatcaactataccacacgcagaattggtccagtgacatac
agcctggatggctgtattaggaatcttcagatggaacaagcccctgttaatctggaccag
cctacctccagttttcacattgggacatgctttgcaaatgcagagagcgggacttacttt
gatggaaccggttttgctaaagcagttggtgggttcaaagttggattggaccttcttgtg
gaatttgaattccgtaccacaagacccactggagtcctcctgggagtcagcagtcagaag
atggatggaatgggtattgaaatgatcgacgagaagcttttgttccatgtggataacggc
gctggccgattcactgcagtctatgatgctgggatcccaggccacatgtgcaatggacag
tggcataaagtcaccgccaagaagatcaaaaaccgtcttgagctggtggtagatgggaac
caggtgaatgcccagagcccaaactcagcatcaacatcagctgatacgaacgaccctgtt
tttgttggcggtttcccaggtggcctcaatcagtttggcctgaccaccaacattaggttc
cgaggctgcatccgatctctgaagctcaccaaaggcactggcaaaccgctggaggttaat
tttgccaaggccctggaactgaggggtgttcaacctgtatcatgcccgactacctaa

KEGG   Mus caroli (Ryukyu mouse): 110302955
Entry
110302955         CDS       T05910                                 

Gene name
Lama4
Definition
(RefSeq) laminin subunit alpha-4 isoform X1
  KO
K06241  laminin, alpha 4
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04151  PI3K-Akt signaling pathway
mcal04510  Focal adhesion
mcal04512  ECM-receptor interaction
mcal05143  African trypanosomiasis
mcal05145  Toxoplasmosis
mcal05146  Amoebiasis
mcal05165  Human papillomavirus infection
mcal05200  Pathways in cancer
mcal05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    110302955 (Lama4)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    110302955 (Lama4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110302955 (Lama4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110302955 (Lama4)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    110302955 (Lama4)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    110302955 (Lama4)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    110302955 (Lama4)
   05145 Toxoplasmosis
    110302955 (Lama4)
   05143 African trypanosomiasis
    110302955 (Lama4)
SSDB
Motif
Pfam: Laminin_G_2 Laminin_G_1 Laminin_I Laminin_II Laminin_EGF Laminin_G_3 Sec34 BORCS6
Other DBs
NCBI-GeneID: 110302955
NCBI-ProteinID: XP_021029462
Ensembl: MGP_CAROLIEiJ_G0015242
LinkDB
Position
10
AA seq 1825 aa
MAWSTAWCSVLALWLLWGAVCSNAASGDGNAFPFDFEGSAVVGRQDPSETSDSGVTLGSL
LPAAERCDAGFFRTLSGECAPCDCNGNSHECLDGSGFCLHCQRNTTGEHCEKCLDGYIGD
SIRGTPRFCQPCPCPLPHLANFAESCYRKNGAVRCICKENYVGPNCERCAPGYYGNPLLI
GSTCKKCDCSGNSDPNLIFEDCDEITGQCRNCLRNTTGFKCERCAPGYYGDARTAKNCAV
CNCGGGPCDSVTGECLEEGFEVPTGKNCPTIRKSCDKCVWDLTDDLRLAALSIEESKSGL
LSVSSGAAAHRHVTDMNSTIHLLRTRLSERENQYTLRKIQINNSENTLRSLLPDVEGLHE
KGSQASRKGMLVEKESMDTIDQATQLVEQAHNMRDKIQEINSKMLYYGENQELGPEEIAE
KLVLAQKMLEEIRSRQPFLTHRELVDEEADEAQELLSQAENWQRLHNDTRSLFPVVLEQL
DDYNAKLSDLQESINQALDHVRDAEDMNRAITSKQRDHEKQHERVKEQMEAVGASLSMSA
DSLTIPRLTLEELDEIIKNASGIYAEIDGAKNELQGKLSNLSNLSHDLVQEATDHAYNLQ
QEADELSRNLHSSDMNGLVQKALDASNVYENIANYVSEANETAELALNITDRIYDAVSGI
DTQIIYHKDESDNLLNQARELQAKADSSNDEAVADTSRRVGGALWRKGALRDRLNDAVKQ
LQATERGDAHQRLGQSKLFIEEANKTTAAVQQVTTPMANNLSNWSQNLQTFDSSAYNTAV
DSARDAVRNLTEVVPQLLDQLRTVEQKRPASNISASIQRIRELIAQTRSVASKIQVSMMF
DGQSAVEVHPKVSVDDLKAFTSISLYMKPPPKPAEPTGAWVADQFVLYLGSKNAKKEYMG
LAIKNDNLVYVYNLGMKDVEILLDSKPVSSWPAYFSIVKIERVGKHGKVFLTVPSLSSTA
EEKFIKKGEFAGDDSLLDLTPEDTVFYVGGVPANFKLPASLNLPSYSGCLELATLNNDVI
SLYNFKNIYNMDPSKSVPCARDKLAFTQSRAASYFFDGSSYAVVRDITRRGKFGQVTRFD
IEIRTPADNGLVLLMVNGSMFFSLEMRNGYLHVFYDFGFSNGPVHLEDTLKKAQINDAKY
HEISIIYHNDKKMILVVDRRHVKSTDNEKKKIPFTDIYIGGAPQEVLQSRTLRAHLPLDI
NFRGCMKGFQFQKKDFNLLEQTETLGVGYGCPEDSLISRRAYFNGQSFIASIQKISFFDG
FEGGFNFRTLQPNGLLFYYTSGSDVFSISLDNGTVVMDVKGIKVMSTDKQYHDGLPHFVV
TSISDTRYELVVDKSRLGGKNPTKGKAEQTQTTEKKFYFGGSPISPQYANFTGCISNAYF
TRLDRDVEVEDFQRYSEKVHTSLYECPIESSPLFLLHKKGKNSSKPKTNKQGEKSKDAPS
WDPIGLKFLERKAPRDSHCHLSSSPRVIEHAYQYGGTANSRQEFEHKQEDFGEKSQFAIR
LKTRSSHGMIFYVSDQEENDFMTLFLAHGRLVFMFNVGHKKLKIRSQEKYNDGLWHDVIF
IREKSSGRLVIDGLRVLEERLPPSGAAWKIKGPIYLGGVAPGRAVKNVQITSVYSFSGCL
GNLQLNGASIASASQTFSVTPCFEGPMETGTYFSTEGGYVVLDESFNIGLKFEIAFEVRP
RSSSGILVHGHSVNGEYLNVHMRNGQVIVKVNNGVRDFSTSVTPKQNLCDGRWHRITVIR
DSNVVQLDVDSEVNHVVGPLNPKPVDHREPVFVGGVPESLLTPRLAPSKPFTGCIRHFVI
DGRPVSFSKAALVSGAVSVSSCPTA
NT seq 5478 nt   +upstreamnt  +downstreamnt
atggcttggagcacagcttggtgctcagtcctggccctgtggctcctctggggtgctgtc
tgctccaatgcagcgtcaggggacggcaatgcgtttccttttgacttcgaggggagcgca
gtggtcggcaggcaagacccatcggagactagcgactcaggcgtgacactgggaagcctg
ctgccggctgctgagagatgtgacgctggattcttccgcacactgtcaggagaatgtgca
ccctgtgactgtaatggcaattcccatgagtgcttggatggctccggattctgtctgcac
tgccagcggaacacaacaggagagcactgtgaaaaatgtctggatggctatattggagac
tccatcagaggcacaccccggttctgccagccgtgcccctgtcccttgccccacctggcc
aactttgcagaatcctgctacaggaaaaatggagctgttcggtgtatttgtaaagaaaat
tatgttggacctaactgtgaaagatgtgctcctggttactatggaaaccccttactcatt
ggaagcacctgtaagaaatgtgactgcagtggaaattcggatcccaacctgatctttgaa
gactgcgatgaaatcactggccagtgcaggaactgcctacgaaataccaccggattcaag
tgtgaacgctgtgctcctggttactatggagacgccaggacggccaagaactgtgcagtg
tgcaactgtgggggcggcccgtgtgacagcgtaaccggagagtgcttggaagaaggattt
gaagtccctacaggcaagaactgcccaactataaggaaaagctgtgataagtgcgtctgg
gacttgaccgatgacctgcgattagcagcgctctccatcgaagagagcaaatccgggctg
ctgagcgtgtcctctggtgccgcggcgcatagacacgtgactgacatgaactctaccatc
cacctcctcagaacaaggttgtcagaaagagaaaaccagtataccctaagaaagatacag
ataaacaactcggagaacacactgagaagcctcctgcctgatgtagagggactccatgag
aagggaagtcaagcctcaagaaaggggatgctggttgagaaggaaagcatggatacaatt
gaccaagcaacccagcttgtcgagcaagcccacaacatgagggacaaaatccaagagatc
aacagcaagatgctctactatggagagaatcaggaacttggccccgaggaaatagctgag
aagctggtgttggcccagaaaatgctggaagagatccgaagccggcagccattcctcacc
catcgggagctggtagatgaggaggcagatgaggcccaggaattgctgagccaagctgag
aactggcagcggctgcacaatgacacccgctctttattccccgtggtgctggagcagttg
gacgactacaacgctaagctgtccgacctccaggaatccattaaccaggccctcgaccat
gtcagggatgcagaagacatgaatagagccatcacttccaagcagcgggaccatgagaaa
caacacgagagagtgaaggaacagatggaagctgtgggtgcctctctgagtatgtctgca
gactctcttaccatacctcggctcactcttgaggaacttgatgagataataaagaatgca
tctggaatttatgcagaaatagatggagccaaaaatgaactgcaaggaaaactatccaac
ctgagtaacctcagtcatgatttagttcaggaagctacagaccacgcatataaccttcaa
caggaagctgatgagctaagcagaaatttgcacagttcagacatgaacgggctggtacag
aaggctttggatgcatcaaacgtctatgaaaatatcgccaattatgtcagtgaagccaac
gaaacagcagaacttgctctgaatatcactgatcgaatttatgatgctgtgagtgggatt
gacacgcagatcatttaccataaggatgaaagtgacaaccttctcaatcaagccagagag
ctgcaagccaaggcagattctagcaatgatgaagcagtggctgacaccagcaggcgtgtg
ggaggagccctgtggaggaagggcgccctcagagacagactgaatgatgctgttaagcag
ctacaggcaacagagagaggggacgcccaccagcgcctgggccagtccaagctcttcatt
gaggaagctaacaagacgacagcggctgtccaacaggttaccacaccaatggctaacaac
ctcagcaactggtcccagaacctgcagacctttgactcatctgcatataacactgcagtg
gactctgctcgggatgcagtgagaaatctcaccgaggttgtcccccagcttctggatcag
cttcgtactgtggagcagaagcggcctgcaagcaacatttctgccagcatccagaggatc
cgagagctcattgctcaaacaaggagtgtcgcaagcaagatccaagtctccatgatgttt
gatggccagtcagctgtcgaagtgcaccccaaagtcagtgtggatgacctgaaggccttc
acgtccatcagcttgtacatgaagcctcctccaaagccggcagagcccactggggcctgg
gtagcagatcagtttgtcctctacctcggaagcaaaaacgccaaaaaagaatacatgggt
ctggcaatcaaaaatgataacctggtatacgtttacaatttgggaatgaaagatgtggag
attctcctggattccaagcctgtgagctcctggcccgcttactttagtattgtcaagatt
gagagggtagggaaacacggaaaggtgttcttgacagtccccagtctcagtagcacggca
gaagaaaagtttattaagaagggggagtttgcaggagatgactccttgctggatctgacc
cctgaggacactgtgttttacgttggtggggtgcctgcgaacttcaagctccctgccagc
ttaaacctgcccagctactcaggctgcctagagctggccactctgaataatgatgtgatc
agcctgtacaacttcaagaacatctataatatggatccatcaaagtcagtgccctgtgcc
agggacaaactggctttcactcagagtagggctgccagctacttcttcgatggctccagt
tatgcagtggtgagggacatcacgaggagagggaagtttggtcaggtgactcgctttgac
atagaaattcgaacaccagctgacaatggcctcgtgctcctgatggtcaatggcagtatg
tttttcagcctcgaaatgcgcaatggctacctacatgtgttctatgactttggattcagc
aatggccctgtgcatcttgaagacacgttgaaaaaagcccagattaatgatgcaaaatat
catgagatctcaatcatttatcacaacgacaagaaaatgattttggtggtggacagacgg
cacgttaagagcacagacaatgagaagaagaagatccctttcacggacatctacatcgga
ggtgcgccccaagaagtcttacagtccaggaccctaagagcacaccttcccctagatatc
aactttaggggatgcatgaagggcttccagttccaaaagaaagatttcaatttactggag
cagacagaaaccctaggagttggttatggatgcccagaggactctctgatatctcgcaga
gcatatttcaatgggcaaagttttattgcttcaattcagaaaatatctttctttgatggc
tttgaaggaggcttcaatttcagaacattacagccaaatgggttactattctactacaca
tcagggtcggacgtgttttccatttcgctggacaacggcactgttgtcatggacgtaaag
ggcatcaaggttatgtcaacagacaagcagtaccacgatgggctgccccacttcgtggtc
acctccatctcagacacaagatatgaactggtagtagacaaaagccgacttggagggaag
aatccaacaaaagggaaggcagagcagactcaaacaactgagaagaagttctactttggt
ggctcacccatcagtcctcagtatgctaatttcactggatgtataagcaatgcctacttt
accaggttggatagagatgtggaagtcgaagatttccagcgctattccgaaaaggtccac
acttcactctatgagtgtccgattgagtcgtcacctctgtttctccttcacaaaaaagga
aagaattcctcaaagcctaaaacaaacaaacagggagagaagagtaaggatgcgccttca
tgggatcctattggcctgaagtttctggaacggaaagctccaagagattcccactgccac
ctctccagcagccccagggtgatagaacatgcctatcaatatggcggcacggccaacagt
cgccaggagtttgaacacaaacaagaagattttggtgaaaaatcccagtttgccattcgt
ctgaagacccgttcctcacatgggatgattttctatgtctcagaccaagaagagaatgat
ttcatgaccctgttcttggcccatggccgcttggtctttatgtttaacgttggccataag
aaactgaagattagaagccaggagaaatacaatgatggattgtggcatgatgtgatattt
attcgggaaaagagcagtggtcgactggtcattgatggtctacgagtcctagaagaaagg
cttccccctagtggcgctgcctggaaaatcaagggtcccatttatctgggaggagtggct
cccggaagagccgtgaaaaatgtccagattacctccgtctacagtttcagtggctgcctt
ggcaatctccagctcaatggtgcctccatcgcctccgcttctcaaacgtttagcgtgacc
ccttgctttgaagggccaatggaaacaggaacttatttttccacagaaggcggctatgtg
gttctagatgagtctttcaatattgggttaaagtttgaaattgcctttgaagtccgcccc
cggagcagttctggaatccttgtccatggccacagcgtcaacggggaatacctgaacgtg
cacatgagaaacggacaggtcatagtgaaagtcaacaacggtgtcagagacttttctacc
tcagtaactcccaagcagaatctctgtgatggcagatggcacagaattacagttattaga
gattcaaacgtggttcagttggatgtagattcagaagtgaaccatgtagttgggccattg
aatccaaagccagttgatcacagggagcctgtgtttgttggaggtgttccagagtcttta
ctgacaccacgtttggctcccagcaaacccttcacaggctgcatccgtcactttgtaatt
gacggccgcccggtgagcttcagtaaagcagccctggtcagtggtgctgtgagcgtcagc
tcctgtcccacagcctga

KEGG   Mus caroli (Ryukyu mouse): 110305044
Entry
110305044         CDS       T05910                                 

Gene name
Lamb3
Definition
(RefSeq) laminin subunit beta-3 isoform X1
  KO
K06244  laminin, beta 3
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04151  PI3K-Akt signaling pathway
mcal04510  Focal adhesion
mcal04512  ECM-receptor interaction
mcal05145  Toxoplasmosis
mcal05146  Amoebiasis
mcal05165  Human papillomavirus infection
mcal05200  Pathways in cancer
mcal05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    110305044 (Lamb3)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    110305044 (Lamb3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110305044 (Lamb3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110305044 (Lamb3)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    110305044 (Lamb3)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    110305044 (Lamb3)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    110305044 (Lamb3)
   05145 Toxoplasmosis
    110305044 (Lamb3)
SSDB
Motif
Pfam: Laminin_N Laminin_EGF Laminin_II F5_F8_type_C BNR_6
Other DBs
NCBI-GeneID: 110305044
NCBI-ProteinID: XP_021032466
Ensembl: MGP_CAROLIEiJ_G0015068
UniProt: A0A6P7QW04
LinkDB
Position
1
AA seq 1168 aa
MTALFLLWLALPGFLCAQQACSRGACYPPVGDLLIGRTQLLRASSTCGLTKPETYCTQYG
QWQMKCCKCDSRLPRNYNSHRVENVASSSGPMRWWQSQNDVSPVSLQLDLDKRMQLQDIM
MDFKGLTPAGMLIERSSDFGKTWRVYQYLATDCASTFPQVHQGQPKNWQDVRCRPLSQRP
NGHLTGGKVQLNLMDLASAIPASQSKKIQELGDITNLRVNFTKLAPVPQRGSYPPSAYFA
VSQLRLQGSCFCHGHADHCAPNPGGSTTAVQVNDVCVCQHNTAGPNCDRCAPFYNNRPWR
PAEGQDTHECQRCDCNGHSETCHFDPAVFAASQGTNGGVCDNCRDHTEGKNCERCQLHYF
RNRRPSAPIHETCIPCECDPDGAVQGAPCDRLTGQCVCKEYVQGERCDLCKPGFTGLTFA
NPKGCHACDCSILGARKDMPCEEETGRCLCLPNVVGPKCDQCAPSHWKLASGLGCEPCAC
DPRNSLSSQCNQFTGQCPCREGFGGLTCSSAAIRQCPDQTYGHVATGCQACDCDFRGTEG
PGCDKASGRCLCRPGFTGPRCDQCQRGHCDRYPVCVACHSCFQAYDTDLQEQARRLHSLR
NATEGLWTGTGLEDHGLASRLLDAKSKIEQIRQILGGASVTEQDVAQVANGILSIRRTLQ
GLPLDLPLEEEMESFSGDLGNLDRSFSRLLLMYRSKKEQFEKLSSEDPSGAFRMLTMAYE
QSSRAAQQVSDSSSLLSQLRDSRREAEGLERQAGGGGTGGAQLMALRLEMASLPDLTPTI
NKLCGRSRQTACTPGDCPGELCPQDNGTACGSHCRGALPRAKGAFHMAGQVAEQLRSFNT
QLQQTRQMIRAAEEAASRVQADAQRLETQVSTSRLLMEEDVQRTRLLIQQIRGFLTDPDT
DAATIQQVSEAVLALWLPTDSATVLRKMKEIQAIAARLPNVDSVLSQTKQDIARARRLQA
EAEQARSRAHAVEGQVDDVVGNLRQGTVALQEAQDTMQGTGRSLRLIQERVGEVQQVLVP
AERLVKGMKEQMSGFWARMKELRRQAQEEQAQAMQARQLAEGASQQAMNAQEGFKRLKQK
YTELKERLGQSPVLGEQGNRILSIKTEAEELFGETMEMMDKMKDMESELLRGSQAIMLRS
ADLSGLEKRVEQIRSYINGRVLYYATCK
NT seq 3507 nt   +upstreamnt  +downstreamnt
atgacagcacttttcctcttgtggcttgccttgcctggcttcctgtgtgcccagcaagcc
tgctcccgaggggcctgttatccacctgttggggacttgctcattggaaggactcagctt
cttcgagcctcatctacctgtggattgaccaaacctgagacctattgcacccaatatgga
cagtggcagatgaaatgctgcaagtgtgactccaggctgcctcgaaattacaacagtcac
cgagtggagaatgtcgcatcgtcttcaggccccatgcgctggtggcagtcacagaatgat
gtgagccctgtctctctgcagctggacctagacaagaggatgcagcttcaggacatcatg
atggactttaagggtctcacaccagctggcatgttgattgagcgctcttctgactttggc
aagacatggagggtgtaccagtacctggcgacagactgtgccagcacctttccccaggtc
caccagggccagcccaagaactggcaggacgtccggtgccggcccttgtcccagaggcct
aatgggcatctgactgggggaaaggtccaacttaaccttatggatttagcatcagctatc
cctgcatctcaaagtaaaaagattcaagaacttggggacatcacaaacttgagagtcaac
ttcaccaagctggcccctgtgccccagaggggctcctatccacccagcgcctactttgca
gtgtcacagctacgtctacaggggagttgcttctgtcacggacatgccgaccactgtgcc
cctaatcctggaggttctaccactgctgtgcaggtcaacgatgtctgtgtctgccagcat
aacacagctggccccaattgtgaccgctgtgcccccttctacaacaaccgtccatggaga
cctgcagagggccaggacacccacgagtgccaaaggtgtgactgcaatgggcactcagag
acctgccactttgacccagctgtgtttgctgccagccaggggacaaatgggggtgtgtgt
gacaactgccgggaccacaccgagggcaagaactgtgagcgctgtcagctacactatttc
cggaatagacgacccagcgctcccattcatgagacttgtattccctgtgagtgtgatcca
gatggggcagtccagggagctccctgtgaccgactgacgggccagtgtgtgtgcaaagag
tacgtgcaaggagagcgctgtgacctttgcaagcctggcttcaccgggctcacctttgcc
aacccgaagggctgccatgcctgtgactgcagcatcttaggtgcccggaaagatatgcct
tgtgaggaggaaaccggacgctgcttgtgtctgcccaatgtagtgggccccaaatgtgac
cagtgtgccccttctcactggaagctggccagcggcctgggctgtgagccctgtgcctgt
gacccacgcaactccctaagctcccagtgcaaccagtttacagggcagtgtccttgtcgg
gaagggtttggcggcctcacgtgtagttctgcagccatccgtcagtgtcctgaccagacc
tatggacacgtggccacagggtgccaagcttgtgactgtgacttcagaggaacggagggt
cctggctgtgacaaagcctcaggccgctgcctctgccgccctggctttacggggccccgc
tgcgaccaatgccaacgaggtcactgtgaccgctacccagtatgtgtggcctgccactcc
tgcttccaggcctatgacacagacctccaggagcaagctcggcgccttcacagtctccgt
aatgccaccgaaggcctgtggacagggacaggtctggaagaccatggcctggcttctcgg
ttgctagacgccaagagcaagattgagcagatcagacagattctgggaggcgcttctgtc
acagagcaggatgtggctcaggtggccaatggcatcttgtctatcaggagaactcttcag
ggcctgccgctggacctgcccttagaggaggagatggaatccttctctggagacctgggg
aatctagacaggagcttcagtcggctcctccttatgtaccgaagcaagaaggagcaattt
gagaagctaagcagtgaagacccttcaggagccttccgcatgctgaccatggcatatgag
cagtcctcccgagctgcacagcaagtgtctgacagttctagcctgctgagccagctgagg
gacagtcgcagggaggcagagggcctggagagacaggctggaggaggaggcactggagga
gctcagctcatggccctgcgtctagaaatggcttcgctgcctgacttgacacccaccatc
aacaagctttgtggcaggtctaggcagacagcctgtactccaggagattgccctggagag
ctgtgtccccaggacaatggtacagcctgtggctctcactgcaggggagccctgcccaga
gccaaaggggccttccacatggcagggcaggtagctgagcagctacgaagcttcaacacc
cagctccagcagaccaggcaaatgatcagggcagcggaggaagcagcatcaagggtccaa
gctgatgcccagcgccttgagacccaggtgagtaccagccgcttgctgatggaggaagat
gtccagcgcacacggcttctcatccaacagatccggggctttctcacagatcctgacaca
gatgcagccaccatccaacaggtcagtgaggcagtgctggccctctggctgcccaccgac
tcagccacagtgctgcgcaagatgaaagagatccaggccattgcagccaggctccctaat
gtggactcagtgctatcccagaccaagcaagacatcgcacgggcccgcaggctccaggct
gaggctgagcaggccagaagccgagcccacgctgtggaagggcaggtagatgatgtggtc
gggaaccttcggcagggcaccgtggctctgcaggaagctcaggacacaatgcagggtact
ggacgctctcttcggctcatccaggaaagggttggtgaggttcagcaggtccttgtacca
gctgaaaggctggtgaaaggcatgaaagaacagatgagtggattttgggcaaggatgaag
gagcttcgccgccaggcccaagaggagcaggcccaggcaatgcaggcccggcagcttgca
gagggtgccagccagcaggcaatgaatgcccaggagggctttaagagacttaagcaaaag
tatacagagttgaaggagcggctgggtcagagtcctgtgctgggcgagcaaggcaatcga
atcctgagcatcaagacggaggcagaggagctctttggggagaccatggaaatgatggac
aaaatgaaagacatggagtcagagctgcttcgagggagtcaggctatcatgctgcgctcg
gcagacctgtcggggctggagaagcgtgtggagcagatccgcagttacatcaatgggcgc
gtgctctactatgccacctgcaagtga

KEGG   Mus caroli (Ryukyu mouse): 110306938
Entry
110306938         CDS       T05910                                 

Gene name
Lamb1
Definition
(RefSeq) laminin subunit beta-1 isoform X1
  KO
K05636  laminin, beta 1
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04151  PI3K-Akt signaling pathway
mcal04510  Focal adhesion
mcal04512  ECM-receptor interaction
mcal05145  Toxoplasmosis
mcal05146  Amoebiasis
mcal05165  Human papillomavirus infection
mcal05200  Pathways in cancer
mcal05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    110306938 (Lamb1)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    110306938 (Lamb1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110306938 (Lamb1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110306938 (Lamb1)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    110306938 (Lamb1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    110306938 (Lamb1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    110306938 (Lamb1)
   05145 Toxoplasmosis
    110306938 (Lamb1)
SSDB
Motif
Pfam: Laminin_EGF Laminin_N CorA F5_F8_type_C HU-CCDC81_bac_2
Other DBs
NCBI-GeneID: 110306938
NCBI-ProteinID: XP_021034769
Ensembl: MGP_CAROLIEiJ_G0017674
UniProt: A0A6P5QTQ7
LinkDB
Position
12
AA seq 1834 aa
MEGPLSSLPTFAFSPRYLSRKEDPKKRQAACLLRPPSRVASPRLRGLHMGLLQVFAFGVL
ALWGTRVCAQEPEFSYGCAEGSCYPATGDLLIGRAQKLSVTSTCGLHKPEPYCIVSHLQE
DKKCFICDSQDPYHETLNPDSHLIENVVTTFAPNRLKIWWQSENGVENVTIQLDLEAEFH
FTHLIMTFKTFRPAAMLIERSSDFGKTWGVYRYFAYDCESSFPGISTGPMKKVDDIICDS
RYSDIEPSTEGEVIFRALDPAFKIEDPYSPRIQNLLKITNLRIKFVKLHTLGDNLLDSRM
EIREKYYYAVYDMVVRGNCFCYGHASECAPVDGVNEEVEGMVHGHCMCRHNTKGLNCELC
MDFYHDLPWRPAEGRNSNACKKCNCNEHSSSCHFDMAVFLATGNVSGGVCDNCQHNTMGR
NCEQCKPFYFQHPERDIRDPNLCEPCTCDPAGSENGGICDGYTDFSVGLIAGQCRCKLHV
EGERCDVCKEGFYDLSAEDPYGCKSCACNPLGTIPGGNPCDSETGYCYCKRLVTGQRCDQ
CLPQHWGLSNDLDGCRPCDCDLGGALNNSCSEDSGQCSCLPHMIGRQCNEVESGYYFTTL
DHYIYEAEEANLGPGVVVVERQYIQDRIPSWTGPGFVRVPEGAYLEFFIDNIPYSMEYEI
LIRYEPQLPDHWEKAVITVQRPGKIPASSRCGNTVPDDDNQVVSLSPGSRYVVLPRPVCF
EKGMNYTVRLELPQYTASGSDVESPYTFIDSLVLMPYCKSLDIFTVGGSGDGEVTNSAWE
TFQRYRCLENSRSVVKTPMTDVCRNIIFSISALIHQTGLACECDPQGSLSSVCDPNGGQC
QCRPNVVGRTCNRCAPGTFGFGPNGCKPCDCHLQGSASAFCDAITGQCHCFQGIYARQCD
RCLPGYWGFPSCQPCQCNGHALDCDTVTGECLSCQDYTTGHNCERCLAGYYGDPIIGSGD
HCRPCPCPDGPDSGRQFARSCYQDPVTLQLACVCDPGYIGSRCDDCASGFFGNPSDFGGS
CQPCQCHHNIDTTDPEACDKETGRCLKCLYHTEGDHCQLCQYGYYGDALRQDCRKCVCNY
LGTVKEHCNGSDCHCDKATGQCSCLPNVIGQNCDRCAPNTWQLASGTGCGPCDCNAAHSF
GPSCNEFTGQCQCMPGFGGRTCSECQELFWGDPDVECRACDCDPRGIETPQCDQSTGQCV
CVEGVEGPRCDKCTRGYSGVFPDCTPCHQCFALWDAIIGELTNRTHKFLEKAKALKISGV
IGPYRETVDSVEKKVNEIKDILAQSPAAEPLKNIGILFEEAEKLTKDVTEKMAQVEVKLS
DTASQSNSTAGELDALQAEAESLDKTVKELAEQLEFIKNSDIQGALDSITKYFQISLEAE
KRVNASTTDPNSTVEQSALTRDRVEDLMLERESQFKEKQEEQARLLDELAGKLQSLDLSA
AAEMTCGTPPGADCSESECGGPNCRTDEGEKKCGGPGCGGLVTVAHSAWQKAMDFDRDVL
SALAEVEQLSKMVSEAKVRADEAKQNAQDVLLKTNATKEKVDKSNEDLRNLIKQIRNFLT
EDSADLDSIEAVANEVLKMEMPSTPQQLQNLTEDIRERVETLSQVEVILQQSAADIARAE
LLLEEAKRASKSATDVKVTADMVKEALEEAEKAQVAAEAAIKQADEDIQGTQNLLTSIES
ETAASEETLTNASQRISNLERNVEELKRKAAQNSGEAEYIEKVVYSVKQNADDVKKTLDG
ELDEKYKKVESLIAQKTEESADARRKAELLQNEAKTLLAQANSKLQLLEDLERKYEDNQK
YLEDKAQELVRLEGEVRSLLKDISEKVAVYSTCL
NT seq 5505 nt   +upstreamnt  +downstreamnt
atggaagggcccctctcctctctcccaacatttgccttttctccccgctacctctccaga
aaggaagacccgaagaaaagacaggcagcttgcctgctgcgtcctccttcccgtgtcgcg
tcccctcggctgcgaggactgcacatggggctgctccaggtgttcgcctttggtgtccta
gccctatggggcacccgagtgtgcgctcaggaaccggagttcagctatggctgcgcggaa
ggcagctgctaccctgccactggcgaccttcttatcggccgagcgcaaaagctctcagtg
acctcgacatgtggactgcacaagccagagccctactgtattgtcagccacctgcaggag
gacaagaaatgcttcatatgtgactcccaagatccttatcatgagaccctcaatcccgac
agccatctcattgagaatgtggtcacaacatttgctccaaaccgccttaagatttggtgg
caatctgaaaatggtgtggagaacgtgactatccaactggacctggaagcagagttccac
ttcactcatctcatcatgactttcaagacattccgcccagctgccatgctgatcgagcgg
tcttctgactttgggaagacttggggcgtgtacagatacttcgcctacgactgtgagagc
tcgttcccaggcatttcaactggacccatgaagaaagtggatgacatcatctgtgactct
cgatattctgacattgagccctcgacagaaggagaggtaatatttcgtgctttagatcct
gctttcaaaattgaagacccttatagtccaaggatacagaatctattaaaaatcaccaac
ttgagaatcaagtttgtgaaactgcacaccttgggagataaccttttggactccagaatg
gaaatcagagagaagtactattacgctgtttatgatatggtggttcgagggaactgcttc
tgctatggccacgccagcgaatgcgcccctgtggatggagtcaatgaagaagtggaagga
atggttcacgggcactgcatgtgcagacacaacaccaaaggcctgaactgtgagctgtgc
atggatttctaccacgatttgccatggagacctgctgaaggccggaacagcaacgcctgc
aaaaaatgtaactgcaacgaacattccagctcgtgtcactttgacatggcagtcttcctg
gctactggcaacgtcagcgggggtgtgtgtgataactgtcagcacaacaccatggggcgc
aactgtgagcagtgcaaaccgttctacttccagcaccctgagagggacatccgggacccc
aatctctgtgaaccatgtacctgtgacccagctggttctgagaatggcgggatctgtgac
gggtacactgatttttctgtgggtctcattgctggtcagtgtcggtgcaaattgcatgtg
gagggagagcgctgtgatgtgtgtaaagaaggcttctacgacttaagtgctgaagacccg
tatggttgtaaatcatgtgcttgcaatcctctgggaacaattcctggtgggaatccttgt
gattctgagactggctactgctactgtaagcgcctggtgacaggacagcgctgtgaccag
tgcctgccgcagcactggggcttaagcaatgatttggatgggtgtcgaccttgtgactgt
gaccttggaggggcgttgaacaatagctgctccgaggactccggccagtgctcctgcctg
ccccacatgattgggcggcagtgtaacgaggtggagtccggttactacttcaccaccctg
gaccactacatctacgaagccgaggaagccaatctggggcctggagtcgttgtggtggaa
aggcagtacattcaggaccgcattccttcctggacaggacctggcttcgtccgggtgcct
gaaggggcttatttggagtttttcattgacaacataccgtattccatggagtatgaaatc
ctgattcgctatgagccacagctgccagaccactgggagaaagctgtcatcactgtacag
cggccggggaagattccagccagcagccgatgtggtaacacggttcccgatgatgacaac
caggtggtgtccttgtcaccgggttcaagatatgttgtcctccctcgccccgtgtgcttt
gagaagggaatgaactacacggtgaggttggagctgccccagtatacggcatcgggcagt
gacgtggagagcccttacacattcatcgactcgcttgttctcatgccctactgtaaatcg
ctggacatcttcactgttggcggctcaggcgacggggaggtcaccaatagtgcctgggaa
accttccaacgctacaggtgtctggagaacagccggagtgtggtaaaaacacctatgacg
gatgtctgcagaaacattatcttcagcatctctgccttgattcaccagacgggccttgct
tgtgaatgtgaccctcagggatctctgagttccgtgtgtgaccccaacggtggccagtgc
cagtgccgtcctaatgtggttggaagaacctgcaacaggtgtgccccgggcacctttggc
tttggccccaacggatgcaaaccttgtgactgccatctgcaagggtctgccagtgccttc
tgtgacgcgatcactggccagtgccactgtttccagggcatctatgctcggcaatgtgac
cgatgtctccctgggtattggggctttcccagctgccagccctgccagtgtaatggccat
gctctagactgtgacacagtgacaggggagtgtctgagctgtcaggactacaccacaggc
cacaactgcgaaaggtgcctggctggctactacggtgatcccatcattgggtcaggagac
cactgtcgcccttgcccttgtcctgatggtcctgacagtggacgccagtttgccaggagc
tgttatcaagaccccgtcactctccagcttgcgtgtgtttgtgatcctgggtacattggc
tccagatgtgatgactgtgcctctggattttttggcaatccctcagactttgggggttca
tgtcaaccatgtcagtgccaccacaacattgacactaccgatccagaagcctgtgacaag
gagacgggacgatgcctcaagtgcctgtaccacacggaaggggaccattgccagctctgc
cagtatgggtactacggcgatgctcttcggcaagactgtagaaagtgtgtctgcaattac
ctgggcacggtgaaggaacattgtaatggctctgactgccactgtgacaaagccactggt
cagtgctcgtgccttcccaatgtgatcgggcagaactgtgaccggtgtgcgcccaacacc
tggcagctggctagcgggactggctgcgggccctgcgattgcaatgctgcgcattccttt
gggccatcctgcaacgagttcacaggacagtgccagtgcatgccgggctttggaggccga
acctgcagcgagtgccaggagctcttctggggagaccctgatgtggaatgccgagcctgt
gattgtgatcccaggggcattgagacacctcagtgtgaccagtccacgggccagtgtgtc
tgtgtggagggtgtagagggtcctcgctgcgacaagtgcaccagaggttactcgggggtc
tttcctgactgcacaccctgccaccagtgctttgctctctgggatgccatcattggtgaa
ctgaccaacaggacccacaaattcctggagaaagccaaggctctgaaaatcagtggtgtg
attggtccctaccgagagaccgtggactctgtagagaagaaagtcaatgagataaaagac
atcctggcccagagcccagcagcggaaccactgaaaaacattggcattctctttgaggag
gcagagaaattaaccaaagatgtcacagaaaagatggctcaggtagaagtgaaattatct
gatacagcttcacagagtaacagcacagctggagagctcgacgcattgcaggcagaagca
gagagccttgacaagaccgtgaaagagctggcagaacagctggaatttataaaaaactcc
gatattcagggtgccttggatagcatcaccaagtatttccagatctctcttgaggcagag
aagcgggtgaatgcctccaccacagaccccaacagcactgtggagcagtctgccctcacg
agagacagagtagaagatctgatgttggagcgagagtctcagttcaaggagaagcaggag
gaacaggcacgccttctggatgaactggccggcaaactgcaaagtctcgacctgtcggct
gctgcagagatgacctgtgggacgcctccaggggctgactgttccgaaagtgaatgtggc
ggccccaactgcagaactgacgaaggagagaagaagtgtggggggcctggctgtggtggc
ctggtcactgtggcccacagtgcttggcagaaagccatggattttgaccgtgatgtcctg
agtgccctggccgaagtcgaacagctctccaagatggtctctgaagcaaaagtgagagca
gatgaggcgaagcagaatgcacaggatgtcctgttaaaaacaaatgctaccaaagaaaaa
gtggacaagagcaacgaggacctgcggaacctcatcaagcagatcagaaacttcctgact
gaggacagtgctgatctagacagcattgaagcagttgccaatgaagtactgaagatggag
atgcctagcacgccacagcagctacagaacctaacggaagacatccgggagcgagttgaa
accctttctcaagtcgaggttattctgcagcagagtgcagctgacattgccagagctgag
ctgttgcttgaggaagctaagagagcaagcaaaagtgcaacagatgttaaagtcactgca
gacatggtgaaggaagcattagaagaagcagaaaaggcccaggttgcagcagaggcggcg
attaaacaagctgatgaggatatccaaggaacccaaaacctgctaacatcgattgaatct
gaaacggcagcttctgaggaaaccctgaccaacgcctcccagcgcatcagcaatcttgag
aggaacgtggaggagcttaagcgtaaagctgcccagaactctggggaggcagaatatatt
gaaaaagtggtatattctgtaaaacagaacgcagacgatgttaagaagactctagatggc
gaacttgatgaaaagtataagaaggtagaaagtttaattgcccaaaaaactgaagagtca
gcagatgccaggaggaaagctgagctgctacagaatgaagcaaaaacactcttggctcaa
gccaacagcaagctccagctgttggaagacttagaaagaaaatatgaggacaatcaaaaa
tacttggaagataaagctcaagaattagtgcgactggaaggagaggtccgctccctgctt
aaggacataagtgagaaagttgcggtttacagcacctgcttataa

KEGG   Mus caroli (Ryukyu mouse): 110311961
Entry
110311961         CDS       T05910                                 

Gene name
Lamc1
Definition
(RefSeq) laminin subunit gamma-1 isoform X1
  KO
K05635  laminin, gamma 1
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04151  PI3K-Akt signaling pathway
mcal04510  Focal adhesion
mcal04512  ECM-receptor interaction
mcal05020  Prion disease
mcal05145  Toxoplasmosis
mcal05146  Amoebiasis
mcal05165  Human papillomavirus infection
mcal05200  Pathways in cancer
mcal05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    110311961 (Lamc1)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    110311961 (Lamc1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110311961 (Lamc1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110311961 (Lamc1)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    110311961 (Lamc1)
  09164 Neurodegenerative disease
   05020 Prion disease
    110311961 (Lamc1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    110311961 (Lamc1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    110311961 (Lamc1)
   05145 Toxoplasmosis
    110311961 (Lamc1)
SSDB
Motif
Pfam: Laminin_EGF Laminin_N Laminin_B
Other DBs
NCBI-GeneID: 110311961
NCBI-ProteinID: XP_021041224
Ensembl: MGP_CAROLIEiJ_G0014707
UniProt: A0A6P5RE82
LinkDB
Position
1
AA seq 1607 aa
MTGGGRAALALQPRGRLWPLLAVLAAVAGCVRAAMDECADEGGRPQRCMPEFVNAAFNVT
VVATNTCGTPPEEYCVQTGVTGVTKSCHLCDAGQQHLQHGAAFLTDYNNQADTTWWQSQT
MLAGVQYPNSINLTLHLGKAFDITYVRLKFHTSRPESFAIYKRTREDGPWMPYQYYSGSC
ENTYSKANRGFIRTGGDEQQALCTDEFSDISPLTGGNVAFSTLEGRPSAYNFDNSPVLQE
WVTATDIRVTLNRLNTFGDEVFNDPKVLKSYYYAISDFAVGGRCKCNGHASECVKNEFDK
LVCNCKHNTYGVDCEKCLPFFNDRPWRRATAESASECLPCDCNGRSQECYFDPELYRSTG
HGGHCTNCRDNTDGAKCERCRENFFRLGNTEACSPCHCSPVGSLSTQCDSYGRCSCKPGV
MGDKCDRCQPGFHSLTEAGCRPCSCDPSGSTDECNVETGRCVCKDNVEGFNCERCKPGFF
NLESSNPKGCTPCFCFGHSSVCTNAVGYSVYDISSIFQIDEDGWRVEQRDGSEASLEWSS
DRQDIAVISDSYFPRYFIAPAKFLGNQVLSYGQNLSFSFRVDRRDTRLSAEDLVLEGAGL
RVSVPLIAQGNSYPSETTVKYIFRLHEATDYPWRPALSPFEFQKLLNNLTSIKIRGTYSE
RSAGYLDDVTLQSARPGPGVPATWVESCTCPVGYGGQFCETCLPGYRRETPSLGPYSPCV
LCTCNGHSETCDPETGVCDCRDNTAGPHCEKCSDGYYGDSTLGTSSDCQPCPCPGGSSCA
IVPKTKEVVCTHCPTGTAGKRCELCDDGYFGDPLGSNGPVRLCRPCQCNDNIDPNAVGNC
DRLTGECLKCIYNTAGFYCDRCKEGFFGNPLAPNPADKCKACACNPYGTVQQQSSCNPVT
GQCQCLPHVSGRDCGACDPGYYNLQSGQGCERCDCHALGSTNGQCDIRTGQCECQPGITG
QHCERCETNHFGFGPEGCKPCDCHHEGSLSLQCKDDGRCECREGFVGNRCDQCEENYFYN
RSWPGCQECPACYRLVKDKVAEHRVKLQELESLIANLGTGDDMVTDQAFEDRLKEAEREV
TDLLREAQEVKDVDQNLMDRLQRVNSSLHSQISRLQNIRNTIEETGILAERARSRVESTE
QLIEIASRELEKAKMAAANVSITQPESTGEPNNMTLLAEEARRLAERHKQEADDIVRVAK
TANETSAEAYNLLLRTLAGENQTALEIEELNRKYEQAKNISQDLEKQAARVHEEAKRAGD
KAVEIYASVAQLTPVDSEALENEANKIKKEAADLDRLIDQKLKDYEDLREDMRGKEHEVK
NLLEKGKAEQQTADQLLARADAAKALAEEAAKKGRSTLQEANDILNNLKDFDRRVNDNKT
AAEEALRRIPAINRTIAEANEKTREAQLALGNAAADATEAKNKAHEAERIASAVQKNATS
TKADAERTFGEVTDLDNEVNGMLRQLEEAENELKRKQDDADQDMMMAGMASQAAQEAELN
ARKAKNSVSSLLSQLNNLLDQLGQLDTVDLNKLNEIEGSLNKAKDEMKASDLDRKVSDLE
SEARKQEAAIMDYNRDIAEIIKDIHNLEDIKRTLPTGCFNTPSIEKP
NT seq 4824 nt   +upstreamnt  +downstreamnt
atgacgggcggcgggcgggccgcgctggccctgcagccccgggggcggctgtggccgctg
ctggctgtgctggcggctgtggcgggctgtgtccgggcggccatggacgagtgcgcggat
gagggcggccggccgcagcgctgcatgccggagtttgttaatgccgccttcaatgtgacc
gtggtggctaccaacacgtgtgggactccgcccgaggagtactgcgtgcagactggggtg
accggagtcactaagtcctgtcacctgtgtgacgccggccagcagcacctgcaacacggg
gcagccttcctgaccgactacaacaaccaggccgacaccacctggtggcaaagccagact
atgctggccggggtgcagtaccccaactccatcaacctcacgctgcacctgggaaaggct
tttgacatcacttacgtgcgcctcaagttccacaccagccgtccagagagcttcgccatc
tataagcgcactcgggaagacgggccctggatgccttaccagtactacagtgggtcctgt
gagaacacatactcaaaggctaaccgaggcttcatcaggaccggaggggatgagcagcag
gccttgtgtactgatgaattcagtgacatttcccccctcaccggcggcaacgtggccttt
tcaaccctggaaggacggccaagtgcctacaactttgacaacagccccgtgctccaggaa
tgggtaactgccactgacatcagagtgacgctcaatcgcctgaacacctttggagatgaa
gtgtttaacgaccccaaagttctcaagtcttactattacgcaatctcagactttgctgtg
ggcggcaggtgtaaatgtaacggacatgccagcgagtgtgtaaagaacgagtttgacaaa
ctcgtgtgcaactgcaaacataacacatacggagttgactgtgaaaagtgcctgcctttc
ttcaatgaccggccgtggaggagggcgactgctgagagcgccagcgagtgccttccttgt
gactgcaatggccgatcccaagagtgctactttgaccctgaactataccgttccactgga
catggtggccactgtaccaactgccgggataacacagatggtgccaagtgcgagaggtgc
cgggagaatttcttccgcctggggaacaccgaagcctgctctccgtgccactgcagccct
gttggttctctcagcacacagtgtgacagttacggcaggtgcagctgtaagccaggagtg
atgggtgacaagtgtgaccgttgccagcctgggttccattccctcactgaggcaggatgc
aggccatgctcctgcgatccttcgggcagcacagatgagtgtaatgttgaaacaggaaga
tgcgtttgcaaagacaacgttgaaggcttcaactgtgagagatgcaaacctggatttttt
aatctggagtcatctaatcctaagggctgcacaccctgcttctgctttggccattcttct
gtgtgcacaaatgctgttggctacagtgtttatgacatctcctccatctttcagattgat
gaggatgggtggcgcgtggagcagagagacggctcggaggcgtctctggagtggtcctca
gacaggcaggatattgccgtaatctcagacagttactttcctagatacttcatcgcccct
gcgaagttcctgggcaaccaggtcctgagttatgggcagaacctttccttctccttccga
gtggacagacgggacactcgcctctccgcagaggaccttgtgcttgaaggagctggcttg
agagtatccgtgcccttgatcgctcagggcaactcctaccccagcgagaccactgtgaag
tacatcttcaggctccatgaagcaacggattacccttggaggccggctctctccccgttt
gaatttcagaagctgctaaacaacttgacctctatcaagatccgtggtacatacagtgag
aggagtgctgggtacttggatgatgtcaccttgcaaagtgctcgccctgggcccggagtc
cctgcaacgtgggtggagtcctgcacctgtccagtggggtacggggggcagttctgtgag
acgtgcctcccaggctacagaagagaaactccaagccttggaccttacagcccgtgtgtg
ctctgtacctgtaatgggcacagtgagacctgtgacccggagacaggtgtctgtgactgc
agagacaatacagctggcccccactgtgagaaatgtagcgatggatactatggggactca
accctgggcacctcctctgactgccagccttgtccctgccccggtggctcaagttgtgcc
attgtcccaaagacaaaggaagtggtgtgcacgcactgtccgactggcactgccggcaag
agatgtgaactctgtgatgacggctactttggagaccctctgggcagcaatgggcccgtg
agactgtgccgcccgtgccagtgtaacgacaacatagaccccaacgcagttggcaactgc
gaccgcctgacgggcgaatgcctgaagtgcatctataacacggctggtttctactgcgac
cggtgcaaggaagggtttttcggaaatcccctggctcccaatccagccgacaaatgcaaa
gcctgcgcctgcaatccctacgggactgtgcagcagcagagcagctgtaacccggtgacc
ggacagtgccagtgtctgcctcatgtgtctggccgggactgcggtgcttgtgaccctggc
tactacaacctgcagagcgggcaaggctgtgagaggtgtgactgccatgctttgggttcc
accaatgggcagtgtgacatccgcaccgggcagtgtgagtgccagcctggcatcaccggt
cagcactgtgagcgctgtgagaccaaccactttgggtttggacctgaaggctgcaaacct
tgtgactgtcaccatgaaggatccctttcgctccagtgtaaagacgacggccgctgcgaa
tgcagggaaggctttgtgggcaatcgctgtgaccagtgtgaagagaactatttctacaat
cggtcctggcctggctgccaggagtgtccggcttgttaccgactggtgaaggataaggtt
gctgagcatcgagtgaaactccaggagttagagagcctcatcgccaaccttggcactggg
gatgacatggtgacagatcaagcctttgaggacagacttaaggaagcagaaagggaggtg
acagaccttctccgtgaggctcaggaagtcaaagatgtagatcaaaatctgatggatcgc
cttcagagagtaaatagcagcctgcatagccaaatcagccgactgcagaatatccggaat
acgatcgaagagacggggatcttggctgagcgagcacggtcccgagtggagagtacagag
cagctgattgagatcgcctccagggagctcgagaaagcaaaaatggctgccgccaatgtg
tcaatcactcagccagagtctacaggggagccaaacaacatgaccctcttggcagaagaa
gcccgaaggcttgcagagcgtcataaacaggaagccgatgacattgtacgagtggcaaag
acagccaacgagacttcagctgaggcatataatctgcttttgaggaccctggcaggagaa
aatcaaactgcgctggagattgaagagcttaaccggaagtatgaacaagcaaagaacatc
tctcaggacctggagaagcaggctgcccgagtccatgaggaagccaagcgtgcaggtgac
aaagccgtagagatctatgccagtgtggcccagctgacccctgtggactctgaggccctg
gagaatgaagcaaataaaatcaagaaagaagctgcagacctggaccgtctgattgaccag
aagctaaaggattacgaggacctcagggaagacatgagaggaaaggaacatgaagtgaag
aaccttctagagaaggggaaagctgaacaacagactgccgaccaactcctagctcgagct
gacgctgccaaggcccttgctgaagaagctgctaagaagggacgcagtaccttacaagaa
gccaatgacattctcaacaacctgaaagattttgatagacgcgtgaacgataacaagaca
gccgcggaagaagctctaaggagaattcccgccatcaaccggaccatagctgaagccaat
gagaagacaagggaggcccagctggcgctgggcaacgctgccgctgatgccacggaggcc
aagaacaaggcccatgaggcggagaggatcgccagcgccgtgcagaagaatgccaccagt
accaaggcggacgcggaaagaaccttcggggaagttacagatctggataacgaggtgaac
ggcatgctgaggcagctagaggaggcagagaatgagctgaagaggaagcaagatgacgcc
gaccaggacatgatgatggcggggatggcttcgcaggctgctcaggaggctgagctcaat
gccagaaaggccaaaaactctgtcagcagcctcctcagccagctgaacaacctcttggat
cagctgggacagctggacacagtggacctgaacaagctcaatgagatcgaaggctccctg
aacaaagccaaagacgaaatgaaggccagcgacctggacaggaaggtgtctgacctggag
agcgaggctcggaagcaggaggcagccatcatggactataaccgggacatagcagagatc
attaaggatattcacaacctggaggacatcaagaggaccctaccaaccggctgcttcaac
accccatccatcgagaagccctag

KEGG   Mus caroli (Ryukyu mouse): 110312505
Entry
110312505         CDS       T05910                                 

Gene name
Lamc3
Definition
(RefSeq) laminin subunit gamma-3
  KO
K06247  laminin, gamma 3
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04151  PI3K-Akt signaling pathway
mcal04510  Focal adhesion
mcal04512  ECM-receptor interaction
mcal05145  Toxoplasmosis
mcal05146  Amoebiasis
mcal05165  Human papillomavirus infection
mcal05200  Pathways in cancer
mcal05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    110312505 (Lamc3)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    110312505 (Lamc3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110312505 (Lamc3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110312505 (Lamc3)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    110312505 (Lamc3)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    110312505 (Lamc3)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    110312505 (Lamc3)
   05145 Toxoplasmosis
    110312505 (Lamc3)
SSDB
Motif
Pfam: Laminin_EGF Laminin_N Laminin_B XhlA IFT20
Other DBs
NCBI-GeneID: 110312505
NCBI-ProteinID: XP_021041816
Ensembl: MGP_CAROLIEiJ_G0023419
UniProt: A0A6P5RFF1
LinkDB
Position
2
AA seq 1581 aa
MAVSGVLSLLATVASMALVILETHFAAGAGMGSCYDGAGRAQRCLPEFENAAFGRRAEAS
HTCGRPPEDFCPHVGAPGAGLQCQRCDDADPRRRHDASYLTDFHSPDDSTWWQSPSMAFG
VQYPTSVNLTLRLGKAYEITYVRLKFHTSRPESFAIYKRTYASGPWEPYQYYSASCQKTY
GRPEGHYLRPGEDERVAFCTSEFSDISPLSGGNVAFSTLEGRPSAYNFEESPVLQEWVTS
TDLLISLDRLNTFGDDIFKDPRVLQSYYYAVSDFSVGGRCKCNGHASECEPNAAGQLACR
CQHNTTGVDCERCLPFFQDRPWARGTAEDANECLPCNCSGHSEECTFDRELYRSTGHGGH
CQRCRDHTTGPHCERCEKNYYRWSPKTPCQPCDCHPAGSLSLQCDNSGICPCKPTVTGWK
CDRCLPGFHSLSEGGCRPCTCNIAGSLGTCDPRSGNCPCKENVEGSLCDRCRPGTFNLQP
HNPSGCSSCFCYGHSKVCAPAAGFQEHHIRSDFRHGAGGWHTRSMGVSEHPLQGSQSGLL
LGLRGGEELSAPKKFLGDQRLSYGQPVILTLQVPPGGSLPPMQLRLEGAGLALALRPSSL
PSPQDTRQPRRVQLQFLLQETSEEAESPLPTFHFQRLLSNLTALSIWTSGQGPGHSGQVL
LCEVQLTSARPQRELAPPASWVETCLCPQGYTGQFCEFCAPGYKREIPHGGPYANCIPCT
CNQHGTCDPNTGICLCGHHTEGPSCERCMPGFYGNAFSGHADDCQPCPCPGQSACATIPE
SGDVVCTHCPPGQRGRRCESCEDGFFGDPLGLSGAPQPCRQCQCNGNVDLNAVGNCDPHS
GHCLRCLYNTTGAHCEHCLEGFYGSAVATRPVDKCAPCSCDLRGSVSEKTCNPVTGQCVC
LPYVSGRDCSHCSPGFYDLQSGRGCQSCKCHPLGSLENKCHPKTGQCPCRPGVTGQACDR
CQLGFFGFSIKGCRDCRCSPLGAASSQCHENSTCVCRPGFVGYKCDRCQDNFFLADGDTG
CQECPTCYALVKEEAAKLKARLMLMEGWLQRSDCGSPWGPLDILQGEAPLGDVYQGHHLL
QEARGTFLQQMVGLEDSVKATWEQLQVLRGHVHCAQAGAQKTCIQLAELEETLQSSEEEV
LRAASALSFLASLQKGSSAPTNWSHLASEAQILARSHRDMATKIEATSERALLASNASYE
LLKLMDGRVASEAQQELEDRYQEVQAAQTALGIAVVEVLPKAEKALAMVKQVIGDAAPHL
GSLVTPEATNFQARDLSWKVKALEQKLKQKEPEAGQAVGALQVEAGRALEKMEPFMQLHN
KTTAAFTRASSAVQAAKVTVIGAETLLADLEGMKLRSPLPKEQAALKKKAGSIRTRLLED
TKRKTKQAERMLGNAASLSSNAKKKSKEAELMSKDNAKLSRALLREGKQGYRHASRLASQ
TQATLRRASRLLLTSEAHKQELEETKQVTSGLSTVERQIRESRISLEKDTKVLSELLVKL
GSLGVHQAPAQTLNETQRALESLRLQLDSHGALHHKLRQLEEESARQELQIQSFEDDLAE
IRADKHNLETILSSLPENCAS
NT seq 4746 nt   +upstreamnt  +downstreamnt
atggctgtatccggggtcctgtcgctcctggcaacggtggcatctatggcgctggtgatt
ctggagacacacttcgcggcaggcgcgggcatgggctcttgctacgacggtgcaggacgc
gcacagcgctgtctgcctgagttcgagaacgcggcgttcggccgacgcgctgaggcctcc
cacacgtgcggacggcccccggaggacttctgtccacacgtgggggcaccaggggctggg
ctacagtgccagcgctgcgacgatgctgacccccgacgacgccacgatgcctcctacctc
acagacttccacagccccgatgatagcacctggtggcagagcccatccatggccttcggg
gtgcagtaccccacctcggttaacctgaccttgcgcctagggaaggcctatgagatcacc
tatgtgaggctgaagttccacaccagtcgccctgagagttttgccatctacaagcgcacg
tacgccagtggcccctgggagccctaccagtactacagtgcctcctgccagaaaacctat
ggccgtcctgagggccactacctgcgaccgggcgaggatgagagggtggccttctgcacc
tctgagttcagtgacatctcccccttgagcgggggcaacgtggccttctccaccctggaa
ggccgtcccagtgcctacaactttgaggagagccctgtgctgcaggagtgggtcaccagc
actgacctcctgatctctctggatcggctcaacacgtttggggatgacatcttcaaggac
cccagggtgctccagtcttattactatgctgtgtctgacttctctgtgggtggcaggtgc
aaatgcaatggccacgccagtgaatgcgagcccaacgcggctggtcaactggcttgccgc
tgtcagcacaacaccacaggagtggactgcgaacgttgtctgcccttcttccaggaccgt
ccgtgggcccgcggcaccgccgaggatgccaacgagtgtctgccctgcaactgcagtggg
cactctgaggagtgcacatttgacagggagctctatcggagcacgggccatggtgggcac
tgtcagcgctgccgtgaccacacaactgggccacactgtgagcgctgtgagaagaactat
tacagatggtccccgaagacaccatgccaaccctgtgactgccacccagcaggctctctg
agtctccagtgtgacaactcgggcatctgtccctgcaagcccacagtgacaggctggaag
tgtgatcgctgcctgcctggattccactcactcagtgagggcggctgcagaccctgtacc
tgcaatatcgctggcagcttgggcacctgtgacccccgcagtgggaactgtccctgcaaa
gagaatgtagaaggcagcctgtgtgacagatgccgccccgggacatttaacctgcagccc
cacaatccatcgggctgcagcagctgcttctgttatggccactccaaggtgtgtgctcct
gctgctgggttccaggaacaccacatccgctcagacttccgccatggagctggtggctgg
cataccagaagcatgggagtgtccgagcatcctctgcaagggagccagagtgggcttctc
ctgggcctgcgaggaggggaggagctctcagccccaaagaagttcctgggagaccagaga
ctcagctatggacagccagtcatactgaccctccaagtaccccctggaggctccctacct
cctatgcagctgagactggagggggcaggtttggctctggctctgaggccctccagtcta
cccagccctcaggacaccaggcagccaagacgagttcagctccagttcctcttgcaggag
acttctgaggaggcagagtccccactgcccaccttccacttccagcgcctgctttccaat
ctgactgctctgagcatctggaccagtggccaaggaccgggccattctggccaagtgctc
ttgtgtgaagttcagctcacatcggcccggccccagcgtgagcttgcccctccagcctct
tgggtggagacctgcttatgtccccagggatacacaggccagttctgtgaattctgtgct
ccgggatacaagagagaaatacctcatgggggtccctatgccaactgcatcccctgcacc
tgcaaccagcatggcacctgtgaccccaacacagggatctgcctgtgtggccaccacacc
gagggtccatcctgtgagcggtgcatgccaggtttctacggtaatgccttctcaggccat
gctgatgattgccagccctgtccgtgccctggccaatcagcctgtgcaaccatcccagag
agtggagatgtggtgtgcacacactgccctcctggtcagagaggacgacgatgtgagagc
tgcgaagatggcttttttggggatcctctagggctctctggagctccccagccctgccgc
caatgccagtgcaacgggaacgtggatctcaacgctgtgggcaactgtgatcctcattct
ggccactgcttgcgctgtctgtacaacacgacaggggcccactgcgagcactgtctggag
ggtttctatgggagtgccgtggccacaaggcctgtggacaaatgtgctccctgcagctgt
gacctgaggggctcagtcagtgagaagacctgcaaccctgtgactggccagtgtgtctgc
ctgccttatgtctccgggagggactgcagccactgcagccctggcttctatgacctccag
tctgggaggggctgccagagctgcaaatgtcacccacttggatccttggagaataagtgc
caccccaagactggccagtgtccctgccgacccggtgtcactggccaagcctgtgacaga
tgccagttaggtttctttggcttctccatcaagggctgccgagactgtaggtgctcccca
ctgggtgctgcctcatctcagtgccatgagaacagcacctgtgtgtgccggcctggcttt
gtgggctataaatgcgaccgctgccaggataatttcttcctcgcggacggtgacacaggc
tgccaagagtgtcccacctgctatgccctagtgaaggaagaggcagccaagctgaaggcc
aggctgatgctgatggagggatggcttcagaggtctgactgtggtagcccctggggacca
ctagacattctgcagggagaagcccctctgggggatgtctaccaaggtcaccacctactt
caagaggcccgggggaccttcctgcaacagatggtgggcctggaggattctgtgaaggcc
acttgggagcagttgcaggtgctgagagggcatgtacactgtgcccaggctggagctcag
aagacctgcatccagctggcagagctggaggagacattgcagtcctcagaagaggaggtc
cttcgtgcagcctcagctctctcatttctggcaagtcttcagaaaggatccagcgcaccc
accaattggagtcacctggcatcagaggcccagatcctcgccagaagccacagggacatg
gccaccaagatcgaagctacctcggaaagggccctgcttgcctccaacgccagctatgag
ctcctgaagctgatggatggcagagtggcctcggaagcccagcaggaactggaggacagg
taccaggaggtgcaggcagctcagactgccctgggcatagctgtggtagaggtgctgccc
aaagctgaaaaggcactggccatggtgaagcaagtcattggtgatgcagccccacatctc
ggctcgctggtcacccctgaagcaacgaacttccaagctagggacctgagctggaaagtg
aaggccctggagcagaagctgaagcagaaggagcccgaggcaggtcaggctgtgggagcc
ctgcaggtggaggctgggagagccttggagaagatggagccctttatgcagctacacaat
aagaccacagctgccttcacacgggcttcctcagctgtgcaagctgccaaggtgaccgtc
ataggagcagagaccctgctagctgacctagagggaatgaagctgaggtctcctctaccc
aaggagcaggcagcgctgaagaagaaagcaggcagcatcaggaccaggctcctggaggac
acaaagaggaagaccaagcaggcagagaggatgctgggaaatgctgcctctctctcctcc
aacgccaagaagaaaagcaaagaagcagaactgatgtctaaggacaatgccaagctctcc
agagctttgctgagggaaggcaagcagggctaccgtcatgccagccgacttgccagccag
acccaggccacactccgtcgggcctctcgcctgctgctgacctcagaagcacacaagcag
gagctggaggaaactaaacaggtgacctctgggctgagcactgtggagcgccagatccga
gagtctcggatctccttggagaaggacaccaaggtcctgtcagagctgcttgtgaagctg
gggtccctgggtgtccaccaagcccctgctcagaccctgaacgagacccagcgggcacta
gaaagtttgaggctgcagctggattcccacggagccctgcatcacaaactgaggcagctg
gaggaagagtctgctcgacaggagctgcagattcagagctttgaggacgacctcgctgag
attcgcgctgacaagcacaacttggagaccattctgagcagtctgccagagaactgtgcc
agctag

KEGG   Mus caroli (Ryukyu mouse): 110312520
Entry
110312520         CDS       T05910                                 

Gene name
Lama1
Definition
(RefSeq) laminin subunit alpha-1
  KO
K05637  laminin, alpha 1/2
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04151  PI3K-Akt signaling pathway
mcal04510  Focal adhesion
mcal04512  ECM-receptor interaction
mcal05145  Toxoplasmosis
mcal05146  Amoebiasis
mcal05165  Human papillomavirus infection
mcal05200  Pathways in cancer
mcal05222  Small cell lung cancer
mcal05410  Hypertrophic cardiomyopathy
mcal05412  Arrhythmogenic right ventricular cardiomyopathy
mcal05414  Dilated cardiomyopathy
mcal05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    110312520 (Lama1)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    110312520 (Lama1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110312520 (Lama1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110312520 (Lama1)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    110312520 (Lama1)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    110312520 (Lama1)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    110312520 (Lama1)
   05414 Dilated cardiomyopathy
    110312520 (Lama1)
   05416 Viral myocarditis
    110312520 (Lama1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    110312520 (Lama1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    110312520 (Lama1)
   05145 Toxoplasmosis
    110312520 (Lama1)
SSDB
Motif
Pfam: Laminin_G_1 Laminin_EGF Laminin_G_2 Laminin_I Laminin_B Laminin_N Laminin_II Laminin_G_3 Hepar_II_III DUF2520
Other DBs
NCBI-GeneID: 110312520
NCBI-ProteinID: XP_021041837
Ensembl: MGP_CAROLIEiJ_G0021843
UniProt: A0A6P5R9B7
LinkDB
Position
17
AA seq 3083 aa
MRGSGTGAALLVLLASVLWVTVRSQQRGLFPAILNLATNAHISANATCGEKGPEMFCKLV
EHVPGRPVRHAQCRVCDGNSTNPRERHPISHAIDGTNNWWQSPSIQNGREYHWVTVTLDL
RQVFQVAYIIIKAANAPRPGNWILERSVDGVKFKPWQYYAVSDTECLTRYKITPRRGPPT
YRADNEVICTSYYSKLVPLEHGEIHTSLINGRPSADDPSPQLLEFTSARYIRLRLQRIRT
LNADLMTLSHRDLRDLDPIVTRRYYYSIKDISVGGMCICYGHASSCPWDEEAKQLQCQCE
HNTCGESCDRCCPGYHQQPWRPGTISSGNECEECNCHNKAKDCYYDSSVAKERRSLNTAG
QYSGGGVCVNCSQNTTGINCETCIDQYYRPHKVSPYDDHPCRPCDCDPVGSLSSVCIKDD
RHADLANGKWPGQCPCRKGYAGDKCDRCQFGYRGFPNCIPCDCSTVGSLNEDPCIEPCLC
KKNVEGKNCDRCKPGFYNLKERNPEGCSECFCFGVSDVCDSLTWSISQVTNMSGWLVTDL
MSTNKIRSQQEVLGGHRQISINNTAVMQRLTSTYYWAAPEAYLGNKLTAFGGFLKYTVSY
DIPVETVDSDLMSHADIIIKGNGLTISTRAEGLSLQPYEEYFNVVRLVPENFRDFNTRRE
IDRDQLMTVLANVTHLLIRANYNSAKMALYRLDSVSLDIANPNAIDLAVAADVEHCECPQ
GYTGTSCEACLPGYYRVDGILFGGICQPCECHGHASECDIHGVCSVCTHNTTGDHCDQCL
PGFYGTPSRGTPGDCQPCACPLSIDSNNFSPTCHLTDGEEVVCDQCAPGYSGSWCERCAD
GYYGNPTVPGGTCVPCNCSGNVDPLEAGHCDSVTGECLKCLWNTDGAHCERCADGFYGDA
VTAKNCRACNCHENGSLSGVCHLETGLCDCKPHVTGQQCDQCLSGYYGLDTGLGCVPCNC
SVEGSVSDNCTEEGQCHCAPGVSGKQCDRCSHGFYAFQDGGCTPCDCAHTQNNCDPASGE
CLCPPHTQGLKCEECEEAYWGLDPEQGCQACNCSAVGSTSTQCDVLSGHCPCKKGFGGQS
CHQCSLGYRSFPDCVPCGCDLRGTLPDTCDLEQGLCSCSEDGGTCSCKENVVGPQCSKCQ
AGTFALRGDNPQGCSPCFCFGLSQLCSELEGYVRTPITLAPNQPLLHVVSQSNLKGTIEG
VHFQPPDTLLDAEAVRQHLYAEPFYWRLPKQFQGDQLLAYGGKLQYSVAFYSTLGTGTSN
YEPQVLIKGGRARKHVIYMDAPAPENGVRQDYEVRMKEEFWKYFNSVSEKHVTHSDFMSV
LSNIDYILIKASYGQGLQQSRIANISMEVGRKAVELPAEGEAALLLELCVCPPGTAGHSC
QDCAPGYYREKLPESGGRGPRPLLGPCVPCSCNNHSDVCDPETGKCLSCRDHTSGDHCDL
CASGYYGKVTGLPGDCTPCTCPHHPPFSFSPTCVVEGDSDFRCNACLPGYEGQYCERCSA
GYHGNPRAAGGSCQTCDCNPQGSVHSDCDRASGQCVCKPGATGLHCEKCLPRHILMESDC
VSCDDDCVGPLLNDLDSVGDAVLSLNLTGVSPAPYGILENLENTTKYFQRYLLMENAKKI
RAEIQLEGIAEQTENLQKELTSVLARHQKVNAEMERTSNGTQALATFIEQLHANIKEITE
KVATLNQTVRKDFQPPVSALQSMHQNISSLLGLIKERNFTEMQQNATLELKAAKDLLSRI
QKRFQKPQEKLKALKEANSLLSNHSEQLQAAEELLKEAGSKTQESNLLLLLVKANLKEFR
EKKLRVQEEQNVTSELIAKGREWVDAAGTHTAAAQDTLTQLEHHRDELLLWASKIRSHVD
DLVMQMSKRRARDLVHRAEQHASELQSRAGALDRDLENVRNVSLNATSAAHVHSNIQTLT
EEAETLAADAHKMANQTDLISESLASRGKAVLQRSSRFLKESVGTRRKQQGIKLKLDELK
NLTSQFQESMDNITKQANDSLAILRESPGGMREKGRKARELAAAANESAVKTLEDVLALS
LRVFNTSEDLSRVNATVQETNDLLHNSTMTTLLAGRKMKDMEMQANLLLDRLKPLKTLEE
NLSKNLSEIKLLISRARKQAASIKVAVSADRDCVRAYQPQTSSTNYNTLILNVKTQEPDN
LLFYLGSSSSSDFLAVEMRRGKVAFLWDLGSGSTRLEFPEVSINNNRWHSIYITRFGNMG
SLSVKEASAAENPPVRTSKSPGPSKVLDINNSTLMFVGGLGGQIKKSPAVKVTHFKGCMG
EAFLNGKSIGLWNYIEREGKCNGCFGSSQNEDSSFHFDGSGYAVVEKTLRPTVTQIIILF
STFSPNGLLFYLASNGTKDFLSIELVRGRVKVMVDLGSGPLTLMTDRRYNNGTWYKIAFQ
RNRKQGLLAVFDAYDSSDKETKQGETPGAASDLNRLEKDLIYVGGLPHSKAVRKGVSSRS
YVGCIKNLEISRSTFDLLRNSYGVRKGCALEPIQSVSFLRGGYVEMPPKSLSPESSLLAT
FATKNSSGILLVALGKDAEESGGAQAHVPFFSIMLIEGRIEVHVNSGDGTSLRKALLHAP
TGSYSDGQEHSISLVRNRRVITIQLDENSPVEMKLGPLTEGKTINISNLYIGGLPEDKGT
PMLKMRTSFHGCIKNVVLDTQLLDFTHATGSEQVELDTCLLVEEPMQSLHREHGELPPEP
PTLPQPELCAVDTAPGYVAGAHQFGLSQNSHMVLPLNQSDVRKRLQVQLSIRTFASSGLI
YYVAHQNQMDYATLQLQEGRLHFMFDLGKGRTKVSHPALLSDGKWHTVKTEYIKRKAFMT
VDGQESPSVTVVGNATTLDVERKLYLGGLPSHYRARNIGTITHSIPACIGEMMVNGQQLD
KDRPLSASAVDRCYVVAQEGTFFEGSGYAALVKEGYKVRLDLNITLEFRTSSKNGVLLGI
SSAKVDAIGLEIVDGKVLFHVNNGAGRITATYQPRAARALCDGKWHTLQAHKSKHRIVLT
VDGNAIRAESPHTHSTSADTNDPIYVGGYPAHVKQNCLSSRASFRGCVRNLRLSRGSQVQ
SLDLSRAFDLQGVFPHSCPGPEP
NT seq 9252 nt   +upstreamnt  +downstreamnt
atgcgcggcagcggcacgggagccgcgctcctggtgctcctggcctcggtgctctgggtc
accgtgcggagccagcagagaggcttgttccctgccattctcaacctggccaccaatgcc
cacatcagcgccaatgctacctgtggagagaaggggcctgagatgttctgcaaactcgtg
gagcacgtgccgggccggcctgttcgacatgcccaatgccgggtctgtgatggtaacagt
acgaatcctagagagcgccatccgatatcacatgcaattgatggcacgaacaactggtgg
cagagccccagtattcagaatgggagagagtatcactgggtcactgtcaccctggactta
cggcaggtctttcaagttgcatacatcatcattaaagctgccaatgcccctcggcctgga
aactggattttggagcgctctgtggatggcgtcaagttcaaaccctggcagtactatgcc
gtcagcgatacagagtgtttgacccgctacaaaataactccacggcggggacctcccact
tacagagcagacaacgaagtcatctgcacctcgtattattcaaagctggtgccacttgaa
catggagagattcacacatcactcatcaatggcagacccagcgctgacgacccctcaccc
cagttgctggaattcacctcagcgcggtacattcgccttcgtctgcagcgcatcagaaca
ctcaacgcagacctcatgacccttagccatcgggacctcagagaccttgaccctattgtc
acaagacgttattactattcgataaaagacatttccgttggaggcatgtgcatttgctac
ggccatgctagcagctgcccatgggatgaagaagcaaagcaactacagtgtcagtgtgaa
cacaatacatgtggcgagagctgcgacaggtgctgtcctggctaccatcagcagccctgg
aggcctggaaccatttcctccggtaatgagtgtgaggaatgcaactgtcacaacaaagcc
aaagattgttactatgacagcagtgttgcaaaggagaggagaagtcttaatactgccggg
cagtacagtggaggaggggtttgtgtcaactgctcgcagaataccacagggatcaactgt
gaaacctgtatcgaccagtattacagacctcacaaggtatctccttatgatgaccaccca
tgccgtccctgtgactgtgaccctgtggggtctctgagttctgtctgtatcaaggatgac
cgccatgccgatttagccaatggaaagtggccaggtcagtgtccatgtaggaaaggttat
gcgggagataaatgtgaccgctgccagtttggctaccggggtttcccaaattgcatcccc
tgtgactgcagcactgtcggcagcctgaatgaggatccatgcatagagccgtgtctttgt
aagaaaaatgttgagggtaagaactgtgatcgttgcaagccaggattctacaacttgaag
gaacgaaaccccgagggctgctccgagtgcttctgcttcggtgtctctgatgtctgtgac
agcctcacgtggtccattagtcaggtgaccaatatgtcagggtggctggtcactgacttg
atgagcacaaataagatccggtcccagcaagaggtcctgggtgggcaccgtcagatcagc
atcaacaacacggcggtcatgcagaggctgacttctacttactactgggcagctcctgag
gcctacctcggaaacaagctgacagcatttggtggtttcctgaaatacactgtgtcttac
gacattccagtggagacggtggacagtgacctcatgtctcatgctgacattatcatcaag
gggaatgggctcaccataagcacaagagctgagggcctgtccttgcaaccctatgaggaa
tacttcaacgtggttagacttgtgcctgagaacttccgggactttaataccagaagggag
attgaccgtgaccagctgatgactgtcctagccaatgtgacacatctcttgatcagagcc
aattataattctgctaaaatggcactctataggctggattctgtctctctggacatagca
aacccaaatgctatagacctggcagtggctgctgatgtggaacactgtgaatgtccccaa
ggctacacggggacctcctgtgaggcctgcctccctggctattatcgagtggatgggata
ctctttggaggaatctgtcagccctgcgagtgccacgggcatgcatccgagtgtgacatt
catggagtttgctctgtgtgtacacacaacaccacgggggatcactgtgatcagtgcctg
cctggcttctatgggacaccttcacgtgggaccccaggagactgccagccgtgtgcctgc
cctctctccattgactctaacaatttcagccctacctgccacctcactgatggagaggaa
gtggtctgtgaccagtgtgccccgggttactcaggatcctggtgtgagagatgtgcagat
ggttactatggaaacccaaccgtgccagggggaacctgtgtaccatgcaactgcagtggc
aatgttgatcccttggaggctggccactgtgactctgtcacaggggaatgcctgaagtgc
ttgtggaacacagacggtgcccattgtgagaggtgtgcagatggcttctatggagatgcc
gtgactgccaaaaactgccgagcctgtaactgccacgagaatggctccctttctggcgtc
tgccatctggagactggactgtgtgactgcaaacctcacgtgacaggacagcagtgtgac
cagtgcctgtctggctactacgggttggacacagggcttggctgtgtgccctgtaactgc
agtgtggaaggctccgtatctgacaactgcacagaggaaggacagtgtcactgtgcacca
ggtgtctctgggaaacagtgtgacaggtgttcacacggtttctatgcattccaggatggc
ggctgcacaccctgtgactgtgctcatacccagaataactgtgaccccgcctctggagag
tgtctctgcccgcctcacacgcaggggctgaagtgtgaggaatgtgaagaggcatactgg
ggtctggacccggagcagggatgccaggcttgcaattgcagtgctgtgggatccacgagt
acccagtgtgatgttctctctggccactgcccctgcaaaaaagggtttggtgggcagagc
tgccatcagtgctccttaggctacagaagttttcctgactgtgtcccctgtggctgtgac
ctgagggggacactgcctgacacctgtgacctggaacagggtctctgcagctgctcagag
gacggtggtacctgctcatgcaaggagaatgtcgtgggcccccagtgcagtaagtgccaa
gctggcacctttgccttgcgaggggacaacccgcaaggctgcagcccctgcttctgcttc
ggtctgtcgcagctctgctcagagttggagggttacgtgaggactccaataactctagcc
cccaatcagcccctcctgcatgtggtttcacagagcaacctcaagggcacaattgaaggc
gtgcatttccagcctcctgacaccttgctggatgcagaggctgtccgccagcacctctat
gcagagccattttactggcggctaccaaagcagttccagggagaccagctcttggcctat
ggtgggaaactccagtacagtgtggctttctactctacacttggcaccggaacatccaat
tatgagcctcaagtcctcatcaaaggaggtcgggccaggaagcacgtcatttatatggat
gccccagcacctgagaatggagtgagacaggattacgaagtgcggatgaaagaggaattc
tggaaatattttaactctgtgtctgagaaacacgtcacacactctgattttatgtctgtt
ctcagcaatattgactacatcctcatcaaagcatcatacggccagggactgcagcagagc
agaattgccaacatttccatggaggttggcaggaaagctgtcgagctgcccgctgagggc
gaggcggcgttgctgttggagctctgtgtctgtcctcctggcaccgcaggacactcctgt
caggactgtgctcctgggtactacagagagaagctcccagaaagtggtggcaggggaccc
cgccctctgctgggtccttgtgtgccctgcagttgcaacaaccacagcgatgtctgtgac
cccgaaactggaaagtgtctgagctgcagggaccacacatccggggaccactgtgatctg
tgtgcttctggctactatgggaaggtgactggactgcctggagattgtaccccatgcacc
tgtcctcatcaccctcctttcagtttcagccccacttgtgtcgtggaaggtgacagtgat
ttccggtgcaatgcctgcctccctggctatgaaggacagtactgtgaaaggtgctctgca
ggttatcacggcaaccctcgagcagcaggtggtagctgccaaacgtgtgattgcaacccc
caaggctctgtccacagtgactgtgaccgtgcatctgggcagtgtgtctgcaagccagga
gctacagggctccactgcgagaaatgcctgccgagacacatcctgatggagagcgactgt
gtttcctgtgatgatgactgtgtgggtcctttgctgaacgacctggattctgttggtgat
gccgttctgtctctgaacctcacgggtgtttcccctgctccctatggaatcctggaaaat
ctggaaaatacaactaaatatttccagaggtatttattaatggaaaatgccaagaagatt
cgagcagagatccagctcgaagggattgcagagcaaacagaaaatctacaaaaggagctc
accagcgtgttagcacgccatcagaaggtgaacgccgaaatggaaagaacttccaacggg
actcaagccctggccacgttcattgagcagctacatgcaaacatcaaagaaatcacagaa
aaggtggcaacgttgaatcagacggtgcgtaaagatttccagccacccgtgtctgccctt
cagagcatgcaccagaacatttcgtctctgctgggactcatcaaggaaaggaatttcaca
gagatgcagcagaatgctacccttgagctcaaggctgctaaagacttattgtcacggatt
cagaaaaggtttcagaagcctcaggaaaagttgaaggcattgaaggaggccaacagcctc
ctttccaaccacagtgagcaactgcaggctgcagaggagctccttaaggaagctggaagc
aagacccaggagagcaacctcctgctgctcctcgtcaaggccaacctgaaagaattccgg
gagaaaaagctgcgtgttcaagaagaacaaaatgtgacctcagagctcattgccaagggt
agagaatgggtggatgctgccgggactcacacagctgctgcacaagacaccctaacacag
ctggagcatcaccgagatgaactccttctgtgggccagcaaaatcaggagccacgtagat
gacctcgtcatgcagatgtccaaacgaagagcccgtgacctggtccacagggcagagcag
catgcttctgagctgcagagcagggcaggagctttggacagagaccttgaaaatgttaga
aacgtgtctttgaatgccaccagtgcggcacacgtccacagcaacatccagacactgaca
gaggaagcagagacgctggctgctgatgctcacaagatggcaaatcagacagacttgatc
tctgaatccctggcttctcgggggaaagcagtccttcagcgctcgtcccggtttctaaag
gaaagcgtgggtaccaggaggaagcagcaaggcattaagttgaagctggatgagttgaaa
aacttgacgagtcaatttcaggagagcatggataacattacgaagcaggccaacgactcc
cttgcgatacttagagaaagtcctggaggtatgagagagaagggcaggaaagccagagag
ctggcagcagcagccaacgagagtgcggtgaagacactggaggatgtgctggctttgagc
ctgagggtcttcaacacatcagaggacctgtccagagtgaatgccacagtccaggagaca
aacgaccttctgcataactccacgatgaccactctgttggctggaagaaaaatgaaagac
atggaaatgcaagccaaccttttattggatcgattgaaacctttgaaaaccctggaggag
aacctgagcaaaaacctgtcagagatcaagctgctgatcagccgggcccggaaacaagcg
gcgtcgatcaaagttgcagtgtctgcagacagagactgcgtccgcgcctatcagcctcag
acttcatctaccaattataacaccttgatcctgaacgtgaagacgcaggagcccgacaac
cttctcttctacctcggcagcagcagcagttctgactttctcgcagtggagatgcggcgg
gggaaggtagcctttctctgggacctgggctccgggtccacgaggttggaattcccagag
gtctccatcaataacaaccgatggcacagcatctacataaccaggtttggaaacatgggg
tccctgagtgtaaaggaagcaagcgctgccgagaacccaccggtcaggacaagcaaatct
cctggaccgtcgaaggttctggacataaacaattcaacgctgatgtttgttggagggctc
ggaggtcagatcaagaaatccccggctgtgaaggttacccattttaagggctgcatggga
gaggccttcttgaatggcaaatcgattggcctgtggaattacatcgagagagaggggaag
tgcaatggctgctttggaagctcccagaacgaagattcctccttccattttgatggaagc
gggtacgccgtggtggagaagacgctccggcccaccgtgacgcagataataatcctcttc
agcaccttctccccgaatggccttcttttctacctggcttcaaatggcaccaaggacttc
ctgtccattgagctggtccgtggcagggtcaaagtgatggtggacctagggtcaggaccc
ctcactcttatgacagacaggcggtataacaatggaacctggtataaaatcgccttccag
cggaaccggaagcaaggactgctggctgtcttcgatgcatatgacagcagtgacaaggag
acaaagcaaggagagactccaggagctgcttccgacctcaatcggctggagaaagacctg
atttacgtgggtggattgcctcattctaaggctgtgaggaaaggggtcagcagcagaagc
tatgtgggctgcatcaagaacctggagatatccaggtccacctttgatttgctgagaaat
tcctacggagtcagaaaaggctgcgcactggagcctatccagagtgtgagtttcctgaga
ggcggctatgtggagatgccacccaagtctctctcacctgagtcatccttgctggccaca
ttcgccaccaagaacagcagcggaatcctcctggttgccctgggcaaggatgcagaggag
tctggtggggctcaggcacatgtgcccttcttttccatcatgctgattgagggacgaatt
gaagtgcatgtcaattctggggacgggaccagtctgaggaaggccctcctgcatgccccc
accggctcctacagtgatggacaggaacactccatctccctggttaggaatcggagagtt
atcaccatacaactggatgagaacagtcctgtagaaatgaagttgggtccactaacagaa
ggaaagacgatcaacatatccaacctgtacatagggggacttccggaggacaaggggacc
ccgatgctcaagatgcggacttcgttccacgggtgtattaaaaacgtggtccttgacact
caacttttggacttcactcatgcgactggctctgagcaagtagagctggacacatgcttg
ctggtcgaagagcccatgcagagtctgcacagagaacacggggaactccctccagaaccc
ccaactttaccacagcctgaactgtgcgcagtagacacggctccggggtatgtggcaggt
gctcaccagttcggcctctcgcagaacagccacatggtgctccctctgaatcagtctgat
gtccggaagaggctccaggtgcagctgagcattcggacatttgcctccagtggcctcatt
tactacgtggctcatcagaaccaaatggactacgccacgctccagctccaagagggccgc
ctgcacttcatgtttgatctcggcaagggccggaccaaggtctcccaccctgccctgctc
agcgatggcaagtggcatacagtcaagacagaatacattaaaaggaaggcgttcatgact
gttgatggccaagagtcccccagtgtgactgtggtgggcaatgcaaccacgctggatgtg
gaaaggaagctgtacctcggaggccttcccagccactacagggccaggaacatcgggact
atcacccacagcatccctgcctgcattggggaaatgatggttaatggccaacaactggat
aaagacagacccttgtctgcctctgctgtggacaggtgctatgtcgtggcccaggaagga
actttctttgaaggaagcggatatgcagctcttgtcaaggaaggctacaaagttcgattg
gatttaaatatcacactggagttccgtacttcctctaagaatggcgtcctcctggggatc
agcagtgccaaagtggatgccattggcctagagattgtagatggcaaggtcttgtttcac
gtcaacaacggtgctggaaggataacagccacctaccagcccagagctgccagagctctc
tgtgacggcaagtggcacacactccaagcccacaaaagcaagcatcgcatcgtcctgacc
gtggatgggaacgccattagggcggaaagcccccacacccattccacctcggcagacacc
aatgaccccatttatgtgggtggctaccctgcccacgtcaaacagaactgcctgagcagc
cgggcctcatttcggggctgtgtgaggaacctcaggctgagcaggggctcacaagtgcag
tccttggacctgagcagagcctttgacctacaaggagtcttccctcattcctgccctggg
cctgagccctaa

DBGET integrated database retrieval system