KEGG   Mus caroli (Ryukyu mouse): 110283629
Entry
110283629         CDS       T05910                                 

Definition
(RefSeq) H-2 class I histocompatibility antigen, TLA(B) alpha chain isoform X1
  KO
K06751  MHC class I antigen
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04144  Endocytosis
mcal04145  Phagosome
mcal04218  Cellular senescence
mcal04514  Cell adhesion molecules
mcal04612  Antigen processing and presentation
mcal04940  Type I diabetes mellitus
mcal05163  Human cytomegalovirus infection
mcal05165  Human papillomavirus infection
mcal05166  Human T-cell leukemia virus 1 infection
mcal05167  Kaposi sarcoma-associated herpesvirus infection
mcal05168  Herpes simplex virus 1 infection
mcal05169  Epstein-Barr virus infection
mcal05170  Human immunodeficiency virus 1 infection
mcal05203  Viral carcinogenesis
mcal05320  Autoimmune thyroid disease
mcal05330  Allograft rejection
mcal05332  Graft-versus-host disease
mcal05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    110283629
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    110283629
   04145 Phagosome
    110283629
  09143 Cell growth and death
   04218 Cellular senescence
    110283629
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    110283629
   04612 Antigen processing and presentation
    110283629
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    110283629
  09163 Immune disease
   05320 Autoimmune thyroid disease
    110283629
   05330 Allograft rejection
    110283629
   05332 Graft-versus-host disease
    110283629
  09166 Cardiovascular disease
   05416 Viral myocarditis
    110283629
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    110283629
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110283629
   05170 Human immunodeficiency virus 1 infection
    110283629
   05168 Herpes simplex virus 1 infection
    110283629
   05163 Human cytomegalovirus infection
    110283629
   05167 Kaposi sarcoma-associated herpesvirus infection
    110283629
   05169 Epstein-Barr virus infection
    110283629
   05165 Human papillomavirus infection
    110283629
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcal04147]
    110283629
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mcal00537]
    110283629
Exosome [BR:mcal04147]
 Exosomal proteins
  Proteins found in most exosomes
   110283629
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mcal00537]
 Antigens
  110283629
SSDB
Motif
Pfam: MHC_I C1-set Ig_3 MHC_I_3 ig C2-set_2 Ig_2 Crystall
Other DBs
NCBI-GeneID: 110283629
NCBI-ProteinID: XP_021004678
Ensembl: MGP_CAROLIEiJ_G0021543
UniProt: A0A6P5NQ13
LinkDB
Position
17
AA seq 383 aa
MRMGTMVPGTLLILLAASPGQTQTCAGSHSLRYFYTALSRPAISEPWYIAVGYLDDTQFV
RFESAGETATYKLRVPWVEQEGPEYWARETEIVTSNAQFFRENLQTMLDYYNLSQNGSHT
IQVMYGCEVEVGSIFRAYEQHGYDGRDYIALNEDLKTWTAEDMAAEITRSKWERAGYTEL
RRTYLEGPCKDSLLRYLMNRKKTQECTDPPKTHVTHHPRPEGDVTLRCWALGFYPADITL
TWQLNGEELIQDTELVETRPAGDGTFQKWAAVVVPSGEEQKYTCHVYHKGLPEPLTLRWE
PPQSSMPNRTTVLAVLGAMVILGFMSGSVMMWMIKDKGRNRDEITAAFQNEREQLSLSTR
VESEALGVEYGLKVRHSASPLVS
NT seq 1152 nt   +upstreamnt  +downstreamnt
atgaggatggggaccatggtgcctggcaccctcctgatcctcctggctgcctcaccaggc
cagacccagacctgcgcaggctcacactcgctgaggtacttctacaccgccttgtcccga
cctgcaatcagcgaaccatggtacattgctgtgggctacctggatgacactcagttcgtg
cgcttcgaaagcgcaggggagactgcgacatataagctccgtgtgccatgggtggagcaa
gaggggcccgagtattgggcgagagagacagagatcgtcacaagcaatgcacagtttttc
cgcgagaatctacagactatgctggactactacaacctgagccaaaatggctctcacacc
atccaggtgatgtatggctgtgaggtggaggtcgggagcatcttccgcgcttatgagcaa
catggctatgatggccgcgattacatcgccctcaatgaagatctgaaaacgtggacagca
gaggacatggcagcagagatcaccagaagcaagtgggagcgggctggttatacagagctc
cgtaggacctacttggagggtccatgcaaggattcgctgctcagatacctgatgaacaga
aaaaagacacaggagtgcacagatcctccaaaaacacatgtgacccatcaccccaggcct
gaaggtgatgtcaccctgagatgctgggccctgggcttctaccctgctgacatcaccctg
acctggcagttgaatggggaggaactgattcaggacacggagcttgtggagaccaggcct
gcaggggatgggaccttccagaagtgggcagctgtggtggtgccttctggggaagagcag
aaatacacatgtcatgtgtaccataaggggctgcctgagcctctcaccctgagatgggag
cctcctcagtccagtatgcccaacagaaccactgttcttgctgtccttggagctatggtc
atcttaggttttatgagcggaagtgttatgatgtggatgataaaggacaaaggtagaaac
agagatgaaatcactgctgcatttcagaatgagagggaacagttgtccctgagcactcga
gttgaatctgaggcactcggggtcgaatatgggctgaaggttcgtcattcagcctcacca
ttggtctcctga

KEGG   Mus caroli (Ryukyu mouse): 110283630
Entry
110283630         CDS       T05910                                 

Definition
(RefSeq) H-2 class I histocompatibility antigen, D-K alpha chain-like isoform X1
  KO
K06751  MHC class I antigen
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04144  Endocytosis
mcal04145  Phagosome
mcal04218  Cellular senescence
mcal04514  Cell adhesion molecules
mcal04612  Antigen processing and presentation
mcal04940  Type I diabetes mellitus
mcal05163  Human cytomegalovirus infection
mcal05165  Human papillomavirus infection
mcal05166  Human T-cell leukemia virus 1 infection
mcal05167  Kaposi sarcoma-associated herpesvirus infection
mcal05168  Herpes simplex virus 1 infection
mcal05169  Epstein-Barr virus infection
mcal05170  Human immunodeficiency virus 1 infection
mcal05203  Viral carcinogenesis
mcal05320  Autoimmune thyroid disease
mcal05330  Allograft rejection
mcal05332  Graft-versus-host disease
mcal05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    110283630
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    110283630
   04145 Phagosome
    110283630
  09143 Cell growth and death
   04218 Cellular senescence
    110283630
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    110283630
   04612 Antigen processing and presentation
    110283630
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    110283630
  09163 Immune disease
   05320 Autoimmune thyroid disease
    110283630
   05330 Allograft rejection
    110283630
   05332 Graft-versus-host disease
    110283630
  09166 Cardiovascular disease
   05416 Viral myocarditis
    110283630
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    110283630
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110283630
   05170 Human immunodeficiency virus 1 infection
    110283630
   05168 Herpes simplex virus 1 infection
    110283630
   05163 Human cytomegalovirus infection
    110283630
   05167 Kaposi sarcoma-associated herpesvirus infection
    110283630
   05169 Epstein-Barr virus infection
    110283630
   05165 Human papillomavirus infection
    110283630
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcal04147]
    110283630
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mcal00537]
    110283630
Exosome [BR:mcal04147]
 Exosomal proteins
  Proteins found in most exosomes
   110283630
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mcal00537]
 Antigens
  110283630
SSDB
Motif
Pfam: MHC_I C1-set MHC_I_C ig Ig_3 C2-set_2 Ig_2 Marek_A
Other DBs
NCBI-GeneID: 110283630
NCBI-ProteinID: XP_021004680
UniProt: A0A6P5NSN5
LinkDB
Position
17
AA seq 390 aa
MPCIPDGTMAPRTLLLLLAAALTLIETRAGSHSMRYFETALSRPGLREPRFISVGYVDDT
QFARFDSDAENPRYEPRALWMEQEGPEYWEEQTQIAKGSEQSFRVDLTTLLGYYNQSAGG
SHTFQRLSGCDLGSDGSLLRGYWQFAYDGHDYIALNEDLKTWTAADLAALITRRKWEQAG
YAERHRAYLEGACVAWLRRHLELGNATLLRTDPPKAHMTHHPRSEGDVTLRCWALGFYPA
DITLTWQLNGEELTQDIELVETRPAGDGTFQKWASVVVPRWKEQNYTCHVEHEGLPQPLT
LRWEPPPSMDSNMVIIAVLVVLGAVITIGAMVAFVLKSRRKIGGKGGNYAPAGGSNSAQG
SALFLEAFKAILPGPAGTKGHLHPDSSMLP
NT seq 1173 nt   +upstreamnt  +downstreamnt
atgccctgtatcccagatgggacaatggcgcctcgaacactgctcctgctgctggcggcc
gccctgaccctgatcgagacccgcgcgggctcacactcgatgcggtatttcgagaccgcc
ctgtcccggcccggcctccgggagccccggttcatctctgtcggctacgtggacgacacg
cagttcgcgcgctttgacagcgacgcggagaatccgagatatgagccgcgggcgctgtgg
atggagcaggagggaccggagtattgggaggagcagacacagatcgctaagggcagtgag
cagagtttccgagtggacctgacgaccctgctcggctactacaaccagagcgcgggcggc
tctcacacattccagcggttgtcaggctgtgacttggggtcggacggaagcctcctccga
gggtactggcagttcgcttatgatggccacgattacattgccctgaacgaagacctgaaa
acgtggacagcggcggacttggcagcactaatcacccgacgcaagtgggagcaggctggt
tatgcagagagacacagggcctacctggagggcgcgtgcgtggcgtggctccgcagacac
ctggagctcgggaatgcgacgctgctgcgcacagatcccccaaaggcccatatgacccat
caccccagatctgaaggtgatgtcaccctgaggtgctgggccctgggcttctaccctgct
gacatcaccctgacctggcagttgaatggggaggagctgacccaggacatagagcttgtg
gagaccaggcctgcaggggatggaaccttccagaagtgggcatctgtggtggtgcctcgt
tggaaggagcagaattatacatgccatgtggaacatgaggggctacctcagcccctcacc
ctgagatgggagcctcctccatccatggactccaacatggtaatcatagctgttctggtt
gtccttggagctgtgatcaccattggagctatggtggcttttgtgttgaagagcaggaga
aaaataggtggcaaaggagggaactatgctccggctggaggcagcaacagtgcccagggc
tctgccttgtttctggaggccttcaaagccatccttcctggtccagcaggcactaaggga
catctgcatcctgacagctccatgctgccctga

KEGG   Mus caroli (Ryukyu mouse): 110283690
Entry
110283690         CDS       T05910                                 

Definition
(RefSeq) class I histocompatibility antigen, Non-RT1.A alpha-1 chain-like
  KO
K06751  MHC class I antigen
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04144  Endocytosis
mcal04145  Phagosome
mcal04218  Cellular senescence
mcal04514  Cell adhesion molecules
mcal04612  Antigen processing and presentation
mcal04940  Type I diabetes mellitus
mcal05163  Human cytomegalovirus infection
mcal05165  Human papillomavirus infection
mcal05166  Human T-cell leukemia virus 1 infection
mcal05167  Kaposi sarcoma-associated herpesvirus infection
mcal05168  Herpes simplex virus 1 infection
mcal05169  Epstein-Barr virus infection
mcal05170  Human immunodeficiency virus 1 infection
mcal05203  Viral carcinogenesis
mcal05320  Autoimmune thyroid disease
mcal05330  Allograft rejection
mcal05332  Graft-versus-host disease
mcal05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    110283690
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    110283690
   04145 Phagosome
    110283690
  09143 Cell growth and death
   04218 Cellular senescence
    110283690
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    110283690
   04612 Antigen processing and presentation
    110283690
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    110283690
  09163 Immune disease
   05320 Autoimmune thyroid disease
    110283690
   05330 Allograft rejection
    110283690
   05332 Graft-versus-host disease
    110283690
  09166 Cardiovascular disease
   05416 Viral myocarditis
    110283690
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    110283690
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110283690
   05170 Human immunodeficiency virus 1 infection
    110283690
   05168 Herpes simplex virus 1 infection
    110283690
   05163 Human cytomegalovirus infection
    110283690
   05167 Kaposi sarcoma-associated herpesvirus infection
    110283690
   05169 Epstein-Barr virus infection
    110283690
   05165 Human papillomavirus infection
    110283690
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcal04147]
    110283690
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mcal00537]
    110283690
Exosome [BR:mcal04147]
 Exosomal proteins
  Proteins found in most exosomes
   110283690
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mcal00537]
 Antigens
  110283690
SSDB
Motif
Pfam: MHC_I C1-set C2-set_2 Ig_3 ig Ig_2
Other DBs
NCBI-GeneID: 110283690
NCBI-ProteinID: XP_021004774
Ensembl: MGP_CAROLIEiJ_G0021548
UniProt: A0A6P5NVF4
LinkDB
Position
17
AA seq 362 aa
MWALIFWLLSHPQDGGAWSHSLHYCYSAVTEPGPGVPSFSASGFLDNQPFIHYDSRSRKA
KPCADWLRENAQYFTHETEVFTNRMKIFQLSLRNIQQYYNSSGTQSQRADGFHQQAGPHT
LQFTYGCEMRDNRTTGHWQYGYDGRDYLTLDLDSMQYIAATFIADYTKRKWQNNEYWLEK
EKTYLEKECILWLQRYLTMGGENFTRTDPPKTIVTHQLKPERDVTLRCWALGFYPADITL
TWQLNGEELTQDMELVETRPAGDGTFQKWASVVVPSGEEQRYTCHVQHEALTQPLVLKWE
PLQLTTPTTGVCARGRCRPQATLLSVLAFPLFGIVLFGLICYRTQVRRKNWPAPSVPEEE
RL
NT seq 1089 nt   +upstreamnt  +downstreamnt
atgtgggctcttatcttctggcttctgagtcacccccaggacggcggagcctggtcccac
tctctgcattactgttactcagctgtgactgagccgggcccgggagttccttcattttcc
gccagtggcttcttagataaccagcccttcatccactacgacagcaggagcaggaaggca
aagccttgtgctgactggctgagggaaaatgcacagtacttcactcacgagacggaggtt
ttcaccaatcggatgaagattttccagttgagcctgagaaacattcagcaatactacaac
agctctggtacccagagtcagagagcagatggcttccaccagcaagcaggccctcacacc
ctccagttcacatacggctgtgagatgcgggacaacaggaccacagggcactggcagtat
ggctacgatggcagggattacctgaccttggacttggactctatgcaatatatagcagcc
accttcattgctgactacaccaagcgcaagtggcaaaacaatgagtactggctggagaaa
gagaagacctacttggagaaggagtgcatcctatggctgcagagatacttaaccatggga
ggagagaactttacacgaactgacccgccaaagacaatagtgactcatcagctcaaacct
gaaagagacgtcaccctaaggtgctgggccctgggcttctaccctgctgacatcaccctg
acctggcagttgaatggggaggagctgacccaggacatggagcttgtggagaccaggcct
gcaggggatggaaccttccagaagtgggcatctgtggtggtgccttctggagaggagcag
agatacacatgccatgtacaacatgaggcactaacccagccccttgttctgaaatgggag
cctcttcagctcaccacacccacgacaggagtatgtgctaggggaagatgtcgtcctcaa
gcaaccttgctgagtgtccttgcatttcctttatttggcatagtactgtttggacttatc
tgctacagaactcaggtcagaagaaagaactggcctgctccatctgttcctgaagaagag
aggctctag

KEGG   Mus caroli (Ryukyu mouse): 110283724
Entry
110283724         CDS       T05910                                 

Definition
(RefSeq) H-2 class I histocompatibility antigen, Q7 alpha chain-like
  KO
K06751  MHC class I antigen
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04144  Endocytosis
mcal04145  Phagosome
mcal04218  Cellular senescence
mcal04514  Cell adhesion molecules
mcal04612  Antigen processing and presentation
mcal04940  Type I diabetes mellitus
mcal05163  Human cytomegalovirus infection
mcal05165  Human papillomavirus infection
mcal05166  Human T-cell leukemia virus 1 infection
mcal05167  Kaposi sarcoma-associated herpesvirus infection
mcal05168  Herpes simplex virus 1 infection
mcal05169  Epstein-Barr virus infection
mcal05170  Human immunodeficiency virus 1 infection
mcal05203  Viral carcinogenesis
mcal05320  Autoimmune thyroid disease
mcal05330  Allograft rejection
mcal05332  Graft-versus-host disease
mcal05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    110283724
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    110283724
   04145 Phagosome
    110283724
  09143 Cell growth and death
   04218 Cellular senescence
    110283724
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    110283724
   04612 Antigen processing and presentation
    110283724
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    110283724
  09163 Immune disease
   05320 Autoimmune thyroid disease
    110283724
   05330 Allograft rejection
    110283724
   05332 Graft-versus-host disease
    110283724
  09166 Cardiovascular disease
   05416 Viral myocarditis
    110283724
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    110283724
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110283724
   05170 Human immunodeficiency virus 1 infection
    110283724
   05168 Herpes simplex virus 1 infection
    110283724
   05163 Human cytomegalovirus infection
    110283724
   05167 Kaposi sarcoma-associated herpesvirus infection
    110283724
   05169 Epstein-Barr virus infection
    110283724
   05165 Human papillomavirus infection
    110283724
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcal04147]
    110283724
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mcal00537]
    110283724
Exosome [BR:mcal04147]
 Exosomal proteins
  Proteins found in most exosomes
   110283724
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mcal00537]
 Antigens
  110283724
SSDB
Motif
Pfam: MHC_I C1-set MHC_I_3 Ig_3 C2-set_2
Other DBs
NCBI-GeneID: 110283724
NCBI-ProteinID: XP_021004837
Ensembl: MGP_CAROLIEiJ_G0021563
UniProt: A0A6P5NSZ5
LinkDB
Position
17
AA seq 373 aa
MRSPALSTLLSLLFIGALALTLVHAGIHSLQFFATTMTQPGLREQSFIFVVFVDDTQFLC
YNNKGKNQRMEPRALWVKQMGPEYWEQQTRTVKVIEKIALVNLQEAMDIYNHSKDGSHVF
QCVYGCEVGPDGLFLRGHEKHAYDGRDYLTLSQDLHYWVAGDTAAQITLRRWEKSGVSEQ
RQSFLKGECVEMLRTYLDIGKETLLRTDPPKAHVTHHPRPEGEVTLRCWALGFYPANIIL
TWQWDEEDLTQDMDLIETRPAGDGTFQKWASVVVPSGEEQRYTCHVQHEALTQPLVLKWD
PSKHTIPIMGITVGLLLLGVVFTGAVVPIVMRKRKGLQIIILKNIPEGLNPGILLGFPIL
PLSHLFIPTDGKG
NT seq 1122 nt   +upstreamnt  +downstreamnt
atgagaagccccgctctctctaccctcctatccttgctgttcattggagctttggccttg
accctggttcacgcaggcatccattccttgcagttttttgccaccaccatgacccagcct
ggtttgagggagcaatccttcatctttgtcgtcttcgtggacgacacacagttcctgtgc
tacaacaataaggggaaaaatcagagaatggagccgcgcgctctgtgggtgaagcagatg
gggccagagtattgggaacagcagaccaggactgtcaaggtcattgagaagattgcccta
gtgaatttgcaagaggccatggacatctacaaccacagcaaggatggctctcacgtcttt
cagtgtgtgtatggctgcgaagtggggccagatggactcttcctccgtgggcatgagaag
cacgcatacgacggccgcgattacctcaccctaagccaggacctgcactactgggtcgca
ggcgacacagctgcgcagatcacgctgcgcaggtgggagaagtctggtgtctctgagcaa
aggcaatccttcttgaagggcgagtgtgtggagatgctccgcacatacctggacataggg
aaggagactctgctaagaacagatcctcccaaggcacatgtgacccatcaccccagacct
gaaggtgaagtcaccctgaggtgctgggccctgggcttctaccctgctaacatcatcctg
acctggcagtgggatgaggaagacctgactcaggacatggacctcattgagaccagacct
gcaggggatggaaccttccagaagtgggcatctgtggtggtgccttctggagaggaacag
agatacacatgtcatgtgcaacatgaggcactaacccagccccttgttctgaaatgggac
ccttctaagcacaccattcccatcatgggaatcacagttggcctgcttctccttggagtt
gtgtttactggagctgtggttcccatagtgatgaggaagaggaaaggtcttcagataata
attctaaaaaacattcctgaagggctgaacccaggaattctgctaggatttcccatcctg
ccgctctcccatctttttattcccacagatggaaaaggatga

KEGG   Mus caroli (Ryukyu mouse): 110283726
Entry
110283726         CDS       T05910                                 

Definition
(RefSeq) HLA class I histocompatibility antigen, A-25 alpha chain-like
  KO
K06751  MHC class I antigen
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04144  Endocytosis
mcal04145  Phagosome
mcal04218  Cellular senescence
mcal04514  Cell adhesion molecules
mcal04612  Antigen processing and presentation
mcal04940  Type I diabetes mellitus
mcal05163  Human cytomegalovirus infection
mcal05165  Human papillomavirus infection
mcal05166  Human T-cell leukemia virus 1 infection
mcal05167  Kaposi sarcoma-associated herpesvirus infection
mcal05168  Herpes simplex virus 1 infection
mcal05169  Epstein-Barr virus infection
mcal05170  Human immunodeficiency virus 1 infection
mcal05203  Viral carcinogenesis
mcal05320  Autoimmune thyroid disease
mcal05330  Allograft rejection
mcal05332  Graft-versus-host disease
mcal05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    110283726
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    110283726
   04145 Phagosome
    110283726
  09143 Cell growth and death
   04218 Cellular senescence
    110283726
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    110283726
   04612 Antigen processing and presentation
    110283726
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    110283726
  09163 Immune disease
   05320 Autoimmune thyroid disease
    110283726
   05330 Allograft rejection
    110283726
   05332 Graft-versus-host disease
    110283726
  09166 Cardiovascular disease
   05416 Viral myocarditis
    110283726
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    110283726
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110283726
   05170 Human immunodeficiency virus 1 infection
    110283726
   05168 Herpes simplex virus 1 infection
    110283726
   05163 Human cytomegalovirus infection
    110283726
   05167 Kaposi sarcoma-associated herpesvirus infection
    110283726
   05169 Epstein-Barr virus infection
    110283726
   05165 Human papillomavirus infection
    110283726
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcal04147]
    110283726
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mcal00537]
    110283726
Exosome [BR:mcal04147]
 Exosomal proteins
  Proteins found in most exosomes
   110283726
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mcal00537]
 Antigens
  110283726
SSDB
Motif
Pfam: MHC_I C1-set Ig_3 ig LapA_dom
Other DBs
NCBI-GeneID: 110283726
NCBI-ProteinID: XP_021004839
Ensembl: MGP_CAROLIEiJ_G0021552
UniProt: A0A6P5NVJ8
LinkDB
Position
17
AA seq 342 aa
MKTFVTEALFLLLQVLLAMTSHSDGTHFFGFFQTLFTLPWLPKPHFISVGFVDDIQFERF
NSRRDVQRTEHCAPWIDQKKPEYWKDNTDLILSYFQDLTEILQRMLKIYNYSVTGYHTIQ
RRYGCYILPRGYFRNGFFEVVFNDHDYIRLNEDLSTWTPVGKFAEILREEWDSSGFTQNV
KNFLKVECVDLFLTELEYGKEILLRTDIPKIHVIRKVRPDKKITLRCWALKFYPAEITLT
WEREESNQTLDMEVTETMPTGDGTFQKWAAVVVLSGEEHRYKCHVNHEGLPESITLRWVP
PEPTISFMHIVIAVVIGALLMGAMMTLLIWKRRTRGKKGSGT
NT seq 1029 nt   +upstreamnt  +downstreamnt
atgaagacctttgttaccgaggctctcttcctgctgctgcaggttctgctggccatgacc
agtcattcagatggtacccacttttttggctttttccaaactctcttcaccttgccctgg
ctgcctaagccccacttcatcagtgttggctttgtggatgatatacagtttgagagattc
aacagcagaagagatgttcagaggacagagcactgtgcaccatggatagatcaaaagaag
ccagagtattggaaggataacacagacctcattctgagctattttcaggatttaacagag
atactgcaaaggatgctcaaaatctacaactacagtgtaactggatatcacacgatccag
agaaggtatggctgctatattctgcctcgagggtatttcagaaatggattctttgaagta
gtcttcaatgaccatgattacatcaggctgaatgaggacctaagcacttggaccccagtg
ggcaagtttgctgagattctcagagaagagtgggactcatcaggttttacacaaaatgtg
aagaatttcctgaaggttgaatgtgtggacttattcctcacagagctggagtatggaaag
gagattttgctgagaacagatatccccaaaatacatgtgatccgtaaggtcagacctgat
aagaaaatcactctgaggtgctgggccttgaaattttaccctgctgaaatcaccttaacc
tgggaaagggaagaaagcaatcaaaccctggacatggaggtcacagagaccatgcctaca
ggggatggaaccttccagaagtgggcagctgttgtggtactttctggagaagaacataga
tataaatgtcatgtgaatcatgaggggctgcctgagtccatcaccctgagatgggtgcct
cctgagcccaccatttcctttatgcatattgttattgctgtggttattggagctctgctt
atgggagctatgatgactttgctgatatggaagagaaggactagaggtaagaaagggtca
gggacttag

KEGG   Mus caroli (Ryukyu mouse): 110283727
Entry
110283727         CDS       T05910                                 

Definition
(RefSeq) HLA class I histocompatibility antigen, A-24 alpha chain-like
  KO
K06751  MHC class I antigen
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04144  Endocytosis
mcal04145  Phagosome
mcal04218  Cellular senescence
mcal04514  Cell adhesion molecules
mcal04612  Antigen processing and presentation
mcal04940  Type I diabetes mellitus
mcal05163  Human cytomegalovirus infection
mcal05165  Human papillomavirus infection
mcal05166  Human T-cell leukemia virus 1 infection
mcal05167  Kaposi sarcoma-associated herpesvirus infection
mcal05168  Herpes simplex virus 1 infection
mcal05169  Epstein-Barr virus infection
mcal05170  Human immunodeficiency virus 1 infection
mcal05203  Viral carcinogenesis
mcal05320  Autoimmune thyroid disease
mcal05330  Allograft rejection
mcal05332  Graft-versus-host disease
mcal05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    110283727
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    110283727
   04145 Phagosome
    110283727
  09143 Cell growth and death
   04218 Cellular senescence
    110283727
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    110283727
   04612 Antigen processing and presentation
    110283727
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    110283727
  09163 Immune disease
   05320 Autoimmune thyroid disease
    110283727
   05330 Allograft rejection
    110283727
   05332 Graft-versus-host disease
    110283727
  09166 Cardiovascular disease
   05416 Viral myocarditis
    110283727
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    110283727
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110283727
   05170 Human immunodeficiency virus 1 infection
    110283727
   05168 Herpes simplex virus 1 infection
    110283727
   05163 Human cytomegalovirus infection
    110283727
   05167 Kaposi sarcoma-associated herpesvirus infection
    110283727
   05169 Epstein-Barr virus infection
    110283727
   05165 Human papillomavirus infection
    110283727
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcal04147]
    110283727
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mcal00537]
    110283727
Exosome [BR:mcal04147]
 Exosomal proteins
  Proteins found in most exosomes
   110283727
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mcal00537]
 Antigens
  110283727
SSDB
Motif
Pfam: MHC_I C1-set Ig_3 ig C2-set_2 MHC_I_2 Ig_2
Other DBs
NCBI-GeneID: 110283727
NCBI-ProteinID: XP_021004840
UniProt: A0A6P5NQD8
LinkDB
Position
17
AA seq 331 aa
MRNTEPCTLLLLLMVALDLNHYCAGSHWLQTFNMVILEPGMLEPRFIQVSYVDSIQYQGF
DSKDPSAGMQPRAAWIKQEPPEYWEKETSRVLELSQVERQVLRLMVKKNGHRMDGYHTLQ
EVYGCNMANDGSFLGGHYRLTYYGYDYLTLNEDLSSWTAEGKGAQHAKSRWENAGEAKRR
KTYLQGECIQKLLRYLDLGKETLLRSDAPQTHVTHHVRPEGNVTLRCWALGFYPADITLT
WKRDGNNHTQDMELPDTRPAGDGTFQKWAAVVVPSGEELRYTCHVHHEGLPEPLTLKWDP
PQTIPIIAILIGLVLGTLVVGTVVIFLVWRK
NT seq 996 nt   +upstreamnt  +downstreamnt
atgaggaacactgaaccctgcacactcctgctcctcctgatggtggccttggacctgaac
cactattgtgcaggatcacactggctgcagactttcaacatggtaattttggagcctggc
atgttggagccccggttcatccaggtcagctatgtagactccatacagtatcagggattt
gacagcaaagacccatctgcagggatgcaacctcgagctgcatggataaagcaggagcca
cctgaatattgggaaaaggagacatcaagagttctggaattgtcacaggtagagagacaa
gttctgcggttaatggtgaaaaaaaatggacacagaatggatggttatcacaccctgcag
gaagtatatggctgcaatatggctaatgatgggagcttcctcggcggtcactaccgactc
acctactatggctatgattacttaaccctaaatgaggacctaagctcttggactgcagag
ggcaagggagctcaacacgcgaagagcaggtgggagaatgcaggtgaagcaaaaaggagg
aagacttacctgcaaggggagtgtatacaaaagcttcttagatacctggaccttggaaag
gagaccttgctgcgctctgatgccccccaaacacatgtgacccaccatgtaagacctgaa
gggaatgtcaccctgaggtgctgggccctgggcttctacccagccgacatcaccctgacc
tggaagagggatgggaacaaccacacccaggacatggagctgccagacaccaggcctgca
ggggatggaaccttccagaagtgggcagctgtggtggttccttctggagaagagctgaga
tacacatgtcatgtgcaccatgaagggttacctgagcctctcactctaaaatgggatcct
ccacaaaccatccccatcatagcaattctcatcggcctggttcttggaaccttggtggtg
ggaactgtggtgatttttctggtatggaggaaataa

KEGG   Mus caroli (Ryukyu mouse): 110283728
Entry
110283728         CDS       T05910                                 

Definition
(RefSeq) HLA class I histocompatibility antigen, B-15 alpha chain-like
  KO
K06751  MHC class I antigen
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04144  Endocytosis
mcal04145  Phagosome
mcal04218  Cellular senescence
mcal04514  Cell adhesion molecules
mcal04612  Antigen processing and presentation
mcal04940  Type I diabetes mellitus
mcal05163  Human cytomegalovirus infection
mcal05165  Human papillomavirus infection
mcal05166  Human T-cell leukemia virus 1 infection
mcal05167  Kaposi sarcoma-associated herpesvirus infection
mcal05168  Herpes simplex virus 1 infection
mcal05169  Epstein-Barr virus infection
mcal05170  Human immunodeficiency virus 1 infection
mcal05203  Viral carcinogenesis
mcal05320  Autoimmune thyroid disease
mcal05330  Allograft rejection
mcal05332  Graft-versus-host disease
mcal05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    110283728
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    110283728
   04145 Phagosome
    110283728
  09143 Cell growth and death
   04218 Cellular senescence
    110283728
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    110283728
   04612 Antigen processing and presentation
    110283728
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    110283728
  09163 Immune disease
   05320 Autoimmune thyroid disease
    110283728
   05330 Allograft rejection
    110283728
   05332 Graft-versus-host disease
    110283728
  09166 Cardiovascular disease
   05416 Viral myocarditis
    110283728
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    110283728
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110283728
   05170 Human immunodeficiency virus 1 infection
    110283728
   05168 Herpes simplex virus 1 infection
    110283728
   05163 Human cytomegalovirus infection
    110283728
   05167 Kaposi sarcoma-associated herpesvirus infection
    110283728
   05169 Epstein-Barr virus infection
    110283728
   05165 Human papillomavirus infection
    110283728
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcal04147]
    110283728
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mcal00537]
    110283728
Exosome [BR:mcal04147]
 Exosomal proteins
  Proteins found in most exosomes
   110283728
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mcal00537]
 Antigens
  110283728
SSDB
Motif
Pfam: MHC_I C1-set Ig_3 ig C2-set_2 Ig_2
Other DBs
NCBI-GeneID: 110283728
NCBI-ProteinID: XP_021004841
Ensembl: MGP_CAROLIEiJ_G0021551
UniProt: A0A6P5NYL5
LinkDB
Position
17
AA seq 331 aa
MRNPGYFAVLCLLLVTIDLPQYFAGSHWLKTFKTVIXEPGILEGRFIQVSYVDSIQFQGF
DSKSETAGMQPRAAWMKQEPPEYWKNETELALSASLTARRTLIYMVTENNNEKNDYHTLQ
EVFGCNVAHDGSFLGGHFGLTYYGYDYIILNEDLNSWTTEGKVGGKFTPDRKQGSWTDSW
RTYLQGECIERLLRCLDLGKETLLRSDAPRTHVTHKVTPEGNVTLRCWALGFYPSDITLT
WKRDGNNHTQDMELPDTRPAGDGTFQKWAAVVVPSGEELRYTCHVHHEGLPGPLTLKWGP
PQTLPIIAILIGLVLVALVVGTVVIFLVRRK
NT seq 996 nt   +upstreamnt  +downstreamnt
atgaggaaccctggatactttgccgtcctttgcctcctattggtaaccatagacctgccc
cagtattttgcaggctcacactggctgaagactttcaagactgtaattatngagcctggc
atattggagggccggttcatccaggtcagctatgtagactccatacagtttcagggattc
gacagcaaatcagagactgcagggatgcaacctcgggctgcttggatgaagcaggagcca
cctgaatattggaagaatgagacagaacttgccctgagcgcttcactgacagcaagacga
actcttatatacatggtgactgaaaataataacgagaagaatgactatcacaccctgcag
gaagtgtttggctgcaatgtggcacatgatgggagcttccttggtggtcacttcgggctc
acctactatggctatgattacatcatcctgaatgaggacctgaactcttggactacagag
ggaaaagtaggtggaaaatttactccagaccggaagcaaggaagctggacagacagttgg
aggacttacctgcaaggggagtgcatagaaaggcttcttagatgcctggaccttggaaag
gaaaccttgctgcgctctgatgcccccagaacacatgtgacccacaaagtaacacctgaa
gggaatgtcaccctgaggtgctgggccctgggtttctacccatctgacatcaccctgacc
tggaagagggatgggaacaaccacacccaggacatggagctgccagacaccaggcctgca
ggggatggaaccttccagaagtgggcagctgtggtggttccttctggagaagagctgaga
tacacatgccatgtgcaccatgaagggttacctgggccactnactctaaaatgggggcct
ccacaaaccctccccatcatagcaattctcatcggcctggttcttgtagctttggtggtg
ggaactgtggtgatttttctggtacggaggaaatga

KEGG   Mus caroli (Ryukyu mouse): 110283729
Entry
110283729         CDS       T05910                                 

Definition
(RefSeq) HLA class I histocompatibility antigen, A-25 alpha chain-like
  KO
K06751  MHC class I antigen
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04144  Endocytosis
mcal04145  Phagosome
mcal04218  Cellular senescence
mcal04514  Cell adhesion molecules
mcal04612  Antigen processing and presentation
mcal04940  Type I diabetes mellitus
mcal05163  Human cytomegalovirus infection
mcal05165  Human papillomavirus infection
mcal05166  Human T-cell leukemia virus 1 infection
mcal05167  Kaposi sarcoma-associated herpesvirus infection
mcal05168  Herpes simplex virus 1 infection
mcal05169  Epstein-Barr virus infection
mcal05170  Human immunodeficiency virus 1 infection
mcal05203  Viral carcinogenesis
mcal05320  Autoimmune thyroid disease
mcal05330  Allograft rejection
mcal05332  Graft-versus-host disease
mcal05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    110283729
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    110283729
   04145 Phagosome
    110283729
  09143 Cell growth and death
   04218 Cellular senescence
    110283729
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    110283729
   04612 Antigen processing and presentation
    110283729
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    110283729
  09163 Immune disease
   05320 Autoimmune thyroid disease
    110283729
   05330 Allograft rejection
    110283729
   05332 Graft-versus-host disease
    110283729
  09166 Cardiovascular disease
   05416 Viral myocarditis
    110283729
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    110283729
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110283729
   05170 Human immunodeficiency virus 1 infection
    110283729
   05168 Herpes simplex virus 1 infection
    110283729
   05163 Human cytomegalovirus infection
    110283729
   05167 Kaposi sarcoma-associated herpesvirus infection
    110283729
   05169 Epstein-Barr virus infection
    110283729
   05165 Human papillomavirus infection
    110283729
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcal04147]
    110283729
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mcal00537]
    110283729
Exosome [BR:mcal04147]
 Exosomal proteins
  Proteins found in most exosomes
   110283729
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mcal00537]
 Antigens
  110283729
SSDB
Motif
Pfam: MHC_I C1-set Ig_3 ig Ig_2 C2-set_2
Other DBs
NCBI-GeneID: 110283729
NCBI-ProteinID: XP_021004843
UniProt: A0A6P5NSZ9
LinkDB
Position
17
AA seq 330 aa
MMNPGPCNFLLLLVALDLTQYCAGSHWLQTFNIVILKPGMLESRSIQVGYIDSIQYQGFD
SKEPTARMQPRAAWMEQEPPEYWEKETAQVLRLSLTNQRLLRYMVMFNEQSKKDYHFLQE
VFGCNVANDGSFLGGHYRFTYYGFDYIILNEDLNSWTTQGEAAESMKTDLVNAGSAEGWR
TYLLGECTERLLRCLELGKETLLRSDAPQTHVTHQVTPEGNVTLRCWALRFYPADITLTW
KRDGNNHTQDMELPDTRPAGDGTFQKWAAVVVPPGEELRYTCHVHHEGLPEPLTLKWEPP
QTIPIIAILIGLVLGTLVVGTVVIFLVWKK
NT seq 993 nt   +upstreamnt  +downstreamnt
atgatgaaccctggaccctgcaacttcctcctcctcttggtggccttggacctgacccag
tattgtgcaggctcacactggctgcagactttcaatattgtgattttgaagcctggcatg
ttggagtcccggtccatccaggtcggctacatagactccatacagtatcagggatttgac
agcaaagaaccgactgcaaggatgcaacctcgggctgcatggatggagcaggaaccacct
gaatattgggagaaggagacagcacaagtcctgcgcttgtcactgacaaaccaaagactt
cttaggtacatggtgatgttcaatgaacagagcaaaaaggattatcacttcctgcaggaa
gtgtttggctgcaatgtggctaatgatgggagcttcctcggtggtcactaccggttcacc
tactatggctttgattacatcatcctgaatgaggacctgaactcctggacaacacaggga
gaggcagctgaaagcatgaagacagacttggtgaatgcaggctcagcagaaggctggagg
acttacctgctaggggagtgcacagaaaggcttcttagatgcctggagcttggaaaggag
accttgctgcgttctgatgccccccaaacacatgtgacccaccaagtaacacctgaaggg
aatgtcaccctgaggtgctgggccctgagattctacccagctgacatcaccctgacctgg
aagagagatgggaacaaccacactcaggacatggagctgccagacaccaggcctgcaggg
gatggaaccttccagaagtgggcagctgtggtggttccccctggagaagagctgagatac
acatgtcatgtgcaccatgaagggttacctgagcctctcactctaaaatgggagcctcca
caaaccatccccatcatagcaattctcatcggcctggttcttggaaccttggtggtagga
actgtggtgatttttctggtgtggaagaaataa

KEGG   Mus caroli (Ryukyu mouse): 110283730
Entry
110283730         CDS       T05910                                 

Definition
(RefSeq) HLA class I histocompatibility antigen, A-24 alpha chain-like
  KO
K06751  MHC class I antigen
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04144  Endocytosis
mcal04145  Phagosome
mcal04218  Cellular senescence
mcal04514  Cell adhesion molecules
mcal04612  Antigen processing and presentation
mcal04940  Type I diabetes mellitus
mcal05163  Human cytomegalovirus infection
mcal05165  Human papillomavirus infection
mcal05166  Human T-cell leukemia virus 1 infection
mcal05167  Kaposi sarcoma-associated herpesvirus infection
mcal05168  Herpes simplex virus 1 infection
mcal05169  Epstein-Barr virus infection
mcal05170  Human immunodeficiency virus 1 infection
mcal05203  Viral carcinogenesis
mcal05320  Autoimmune thyroid disease
mcal05330  Allograft rejection
mcal05332  Graft-versus-host disease
mcal05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    110283730
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    110283730
   04145 Phagosome
    110283730
  09143 Cell growth and death
   04218 Cellular senescence
    110283730
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    110283730
   04612 Antigen processing and presentation
    110283730
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    110283730
  09163 Immune disease
   05320 Autoimmune thyroid disease
    110283730
   05330 Allograft rejection
    110283730
   05332 Graft-versus-host disease
    110283730
  09166 Cardiovascular disease
   05416 Viral myocarditis
    110283730
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    110283730
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110283730
   05170 Human immunodeficiency virus 1 infection
    110283730
   05168 Herpes simplex virus 1 infection
    110283730
   05163 Human cytomegalovirus infection
    110283730
   05167 Kaposi sarcoma-associated herpesvirus infection
    110283730
   05169 Epstein-Barr virus infection
    110283730
   05165 Human papillomavirus infection
    110283730
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcal04147]
    110283730
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mcal00537]
    110283730
Exosome [BR:mcal04147]
 Exosomal proteins
  Proteins found in most exosomes
   110283730
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mcal00537]
 Antigens
  110283730
SSDB
Motif
Pfam: MHC_I C1-set Ig_3 ig C2-set_2 Ig_2
Other DBs
NCBI-GeneID: 110283730
NCBI-ProteinID: XP_021004844
UniProt: A0A6P5NUS5
LinkDB
Position
17
AA seq 329 aa
MRKPGPWDLLLLLVAIDLTQYCAGSHWLQIFNIVILETGMLEARFIQVGYVDSIQFQGFD
SKEPNARMQPRAAWMKQEPPEYWEKETAKALSFSLSGRRILKYMMSANKDKKNDYHTLQE
VYDCNVANDGSFIEGHYRLTYYGYDSLILNEDLNSWTAEGEVGEKFKTYQEQGGMTESWR
TYLQGECVQRLLRYLELGKEALLRSDAPRSHVTHHVRPEGNVTLRCWALGFYPADITLTW
KRDGKNHIQDMEMPDTRPAGDRTFQKWAAVVVPPGEELRYTCHVNHEGLPGPLTLKWEPQ
TIPIIAILIGLVLGASVVGTVVIFLVWKK
NT seq 990 nt   +upstreamnt  +downstreamnt
atgaggaagcctggaccctgggacctcctcctcctgttggtggcgatagacctgacccag
tattgtgcaggctcacactggctgcagattttcaacattgtgattttggagactggcatg
ttggaggcccggttcatccaggtcggatatgtagactccatacagtttcagggatttgac
agtaaagaaccaaatgcaaggatgcaacctcgggctgcttggatgaagcaggagccacct
gaatattgggagaaagagacagcaaaagccctgagcttctcactgtcaggaagacgaata
cttaagtacatgatgtctgcaaataaagacaagaagaatgattatcacaccctgcaggaa
gtgtatgactgcaatgtggcaaatgatgggagcttcatcgaaggtcactaccggctcacc
tactatggctatgattccttaatcctgaatgaggacctgaactcttggactgcagagggt
gaagtaggtgaaaaattcaagacataccaggagcaaggaggcatgacagaaagttggagg
acttacctgcaaggggagtgtgtacaaaggcttcttagatacctggagcttggaaaggaa
gcattgctgcgctctgatgccccccgatcacatgtgacccaccatgtaagacctgaaggg
aatgtcacccttaggtgctgggccctgggcttctacccagctgacatcaccctgacctgg
aagagggatggaaaaaaccacatccaggacatggagatgccagacaccagacctgcaggg
gatagaaccttccagaagtgggcagctgtggtggttcctcctggagaagagctgagatat
acatgtcatgtcaaccatgaagggttacctgggccactcactctgaaatgggagccacaa
accatccccatcatagcaatcctcatcggcctggttcttggagcttcggtggtgggaact
gtggtgatttttctggtatggaagaaataa

KEGG   Mus caroli (Ryukyu mouse): 110283877
Entry
110283877         CDS       T05910                                 

Definition
(RefSeq) H-2 class I histocompatibility antigen, Q10 alpha chain-like
  KO
K06751  MHC class I antigen
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04144  Endocytosis
mcal04145  Phagosome
mcal04218  Cellular senescence
mcal04514  Cell adhesion molecules
mcal04612  Antigen processing and presentation
mcal04940  Type I diabetes mellitus
mcal05163  Human cytomegalovirus infection
mcal05165  Human papillomavirus infection
mcal05166  Human T-cell leukemia virus 1 infection
mcal05167  Kaposi sarcoma-associated herpesvirus infection
mcal05168  Herpes simplex virus 1 infection
mcal05169  Epstein-Barr virus infection
mcal05170  Human immunodeficiency virus 1 infection
mcal05203  Viral carcinogenesis
mcal05320  Autoimmune thyroid disease
mcal05330  Allograft rejection
mcal05332  Graft-versus-host disease
mcal05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    110283877
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    110283877
   04145 Phagosome
    110283877
  09143 Cell growth and death
   04218 Cellular senescence
    110283877
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    110283877
   04612 Antigen processing and presentation
    110283877
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    110283877
  09163 Immune disease
   05320 Autoimmune thyroid disease
    110283877
   05330 Allograft rejection
    110283877
   05332 Graft-versus-host disease
    110283877
  09166 Cardiovascular disease
   05416 Viral myocarditis
    110283877
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    110283877
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110283877
   05170 Human immunodeficiency virus 1 infection
    110283877
   05168 Herpes simplex virus 1 infection
    110283877
   05163 Human cytomegalovirus infection
    110283877
   05167 Kaposi sarcoma-associated herpesvirus infection
    110283877
   05169 Epstein-Barr virus infection
    110283877
   05165 Human papillomavirus infection
    110283877
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcal04147]
    110283877
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mcal00537]
    110283877
Exosome [BR:mcal04147]
 Exosomal proteins
  Proteins found in most exosomes
   110283877
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mcal00537]
 Antigens
  110283877
SSDB
Motif
Pfam: MHC_I
Other DBs
NCBI-GeneID: 110283877
NCBI-ProteinID: XP_021005090
UniProt: A0A6P5NTK9
LinkDB
Position
17
AA seq 237 aa
MRNPGHFAVLCLLLVTIDLLQYCAGSHWLKTFKTVIMEPGILEGRFIQVSYVDSIQFQGF
DSKSETAGMQPRAAWMKQEPPEYWKNETDQALSSSLTGRRTLIYMVTENNNKKNDYHTLQ
EVFGCNVAHDGSFLGGHYGLTYYGYDYIILNEDLNSWTTEGKVGGKFTPDQKQGSVTDIW
RTYLQGKCIERLLRCLDLGKETLLRSDAPRTHVTHKVTPEGNVTLRCWALGFYPSDI
NT seq 711 nt   +upstreamnt  +downstreamnt
atgaggaaccctggacactttgccgtcctttgcctcctattggtgaccatagacctgctc
cagtattgtgcaggctcacactggctgaagactttcaagactgtaattatggagcctggc
atattggagggccggttcatccaggtcagctatgtagactccatacagtttcagggattc
gacagcaaatcagagactgcagggatgcaacctcgggctgcttggatgaagcaggagcca
cctgaatattggaagaatgagacagaccaagcactgagctcttcactgacaggaagacga
actcttatatacatggtgactgaaaataataacaagaagaatgactatcacaccctgcag
gaagtgtttggctgcaatgtggcacatgatgggagcttccttggtggtcactacgggctc
acctactatggctatgattacatcatcctgaatgaggacctgaactcttggactacagag
ggaaaagtaggtggaaaatttactccagaccagaagcaaggaagtgtgacagatatttgg
aggacttacctgcaagggaagtgcatagaaaggcttcttagatgcctggaccttggaaag
gaaaccttgctgcgctccgatgcccccagaacacatgtgacccacaaagtaacacctgaa
gggaatgtcaccctgaggtgctgggccctgggtttctacccatctgacatc

KEGG   Mus caroli (Ryukyu mouse): 110287620
Entry
110287620         CDS       T05910                                 

Definition
(RefSeq) H-2 class I histocompatibility antigen, D-B alpha chain isoform X1
  KO
K06751  MHC class I antigen
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04144  Endocytosis
mcal04145  Phagosome
mcal04218  Cellular senescence
mcal04514  Cell adhesion molecules
mcal04612  Antigen processing and presentation
mcal04940  Type I diabetes mellitus
mcal05163  Human cytomegalovirus infection
mcal05165  Human papillomavirus infection
mcal05166  Human T-cell leukemia virus 1 infection
mcal05167  Kaposi sarcoma-associated herpesvirus infection
mcal05168  Herpes simplex virus 1 infection
mcal05169  Epstein-Barr virus infection
mcal05170  Human immunodeficiency virus 1 infection
mcal05203  Viral carcinogenesis
mcal05320  Autoimmune thyroid disease
mcal05330  Allograft rejection
mcal05332  Graft-versus-host disease
mcal05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    110287620
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    110287620
   04145 Phagosome
    110287620
  09143 Cell growth and death
   04218 Cellular senescence
    110287620
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    110287620
   04612 Antigen processing and presentation
    110287620
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    110287620
  09163 Immune disease
   05320 Autoimmune thyroid disease
    110287620
   05330 Allograft rejection
    110287620
   05332 Graft-versus-host disease
    110287620
  09166 Cardiovascular disease
   05416 Viral myocarditis
    110287620
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    110287620
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110287620
   05170 Human immunodeficiency virus 1 infection
    110287620
   05168 Herpes simplex virus 1 infection
    110287620
   05163 Human cytomegalovirus infection
    110287620
   05167 Kaposi sarcoma-associated herpesvirus infection
    110287620
   05169 Epstein-Barr virus infection
    110287620
   05165 Human papillomavirus infection
    110287620
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcal04147]
    110287620
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mcal00537]
    110287620
Exosome [BR:mcal04147]
 Exosomal proteins
  Proteins found in most exosomes
   110287620
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mcal00537]
 Antigens
  110287620
SSDB
Motif
Pfam: MHC_I C1-set MHC_I_C Ig_3 ig C2-set_2 Ig_2 Psg1 Marek_A
Other DBs
NCBI-GeneID: 110287620
NCBI-ProteinID: XP_021009846
UniProt: A0A6P5P6U3
LinkDB
Position
Unknown
AA seq 372 aa
MGAMAPRTLLLLLAAALAPTQTRAGPHSLRYFETAVSRPGLGEPRFISVGYVDDTQFVRF
DSDAENPRDEPRAPWMEQEGPEYWEENTQRAKGNEQWFRVSLRNLLRYYNQSAGGSHTFQ
LMYGCEVGSDGRLLRGYQQFAYDGRDYIALNEDLKTWTAADMAAQITQRKLEQAGEAERY
RAYLEGECMEWLRRYLERGNATLLRTDPPKAHVTHHPRSESDVTLRCWALGFYPADITLT
WQLNGEEXTQDMELVETRPAGDGTFQKWASVVVPSGKEQNYSCHVXHEGLSQPLSLTWEP
PPSTDANMVIIAVLVVLGALAIFGAXVAFVMMMRRRNTGGKGGDYAPAPGSQSSDMSLPD
CKVMGHDSRSLA
NT seq 1119 nt   +upstreamnt  +downstreamnt
atgggggcgatggctccgcgcacgctgctcctgctgctggcggccgccctggccccgact
cagacccgcgcgggcccacactcgctgaggtatttcgagaccgccgtgtcccggcccggc
ctcggggagccccggttcatctctgtcggctacgtggacgacacgcagttcgtgcgcttc
gacagcgacgcggagaatccgagagatgagccgcgggcgccgtggatggagcaggagggg
ccggagtattgggaggagaacacacagagagccaagggcaatgagcagtggttccgagtg
agcctgaggaacctgctccgctactacaaccagagcgcgggcggctctcacacgttccag
ctgatgtacggctgtgaggtggggtcggacgggcgcctcctccgcgggtaccagcagttc
gcatacgacggccgcgattacattgccctgaacgaagacctgaaaacgtggacggcggcg
gacatggcggcgcagatcacccaacgcaagttggagcaggctggtgaagcagagagatac
agggcctacctggagggcgagtgcatggagtggctccgcagatacctggagcgcgggaat
gcgacgctgctgcgcacagatcccccaaaggcacatgtgacccatcaccccagatctgaa
agtgatgtcaccctgaggtgctgggccctgggcttctaccctgctgacatcaccctgacc
tggcagttgaatggggaggagntgacccaggacatggagcttgtggagaccaggcctgca
ggggatggaaccttccagaagtgggcatctgtggtggtgccttctgggaaggagcagaat
tactcatgccatgtgnancatgaggggttgtctcagcccctctccctgacatgggagcct
cctccatccaccgatgccaacatggtaatcattgctgttctggttgtccttggagctctg
gccatctttggagctntggtggcttttgtgatgatgatgaggaggagaaacacaggtgga
aaaggaggggactatgctccagctccaggctcccagagctctgatatgtctctcccagat
tgtaaagtgatgggtcatgactctcgttctctagcatga

KEGG   Mus caroli (Ryukyu mouse): 110287649
Entry
110287649         CDS       T05910                                 

Definition
(RefSeq) H-2 class I histocompatibility antigen, D-K alpha chain-like isoform X1
  KO
K06751  MHC class I antigen
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04144  Endocytosis
mcal04145  Phagosome
mcal04218  Cellular senescence
mcal04514  Cell adhesion molecules
mcal04612  Antigen processing and presentation
mcal04940  Type I diabetes mellitus
mcal05163  Human cytomegalovirus infection
mcal05165  Human papillomavirus infection
mcal05166  Human T-cell leukemia virus 1 infection
mcal05167  Kaposi sarcoma-associated herpesvirus infection
mcal05168  Herpes simplex virus 1 infection
mcal05169  Epstein-Barr virus infection
mcal05170  Human immunodeficiency virus 1 infection
mcal05203  Viral carcinogenesis
mcal05320  Autoimmune thyroid disease
mcal05330  Allograft rejection
mcal05332  Graft-versus-host disease
mcal05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    110287649
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    110287649
   04145 Phagosome
    110287649
  09143 Cell growth and death
   04218 Cellular senescence
    110287649
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    110287649
   04612 Antigen processing and presentation
    110287649
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    110287649
  09163 Immune disease
   05320 Autoimmune thyroid disease
    110287649
   05330 Allograft rejection
    110287649
   05332 Graft-versus-host disease
    110287649
  09166 Cardiovascular disease
   05416 Viral myocarditis
    110287649
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    110287649
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110287649
   05170 Human immunodeficiency virus 1 infection
    110287649
   05168 Herpes simplex virus 1 infection
    110287649
   05163 Human cytomegalovirus infection
    110287649
   05167 Kaposi sarcoma-associated herpesvirus infection
    110287649
   05169 Epstein-Barr virus infection
    110287649
   05165 Human papillomavirus infection
    110287649
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcal04147]
    110287649
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mcal00537]
    110287649
Exosome [BR:mcal04147]
 Exosomal proteins
  Proteins found in most exosomes
   110287649
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mcal00537]
 Antigens
  110287649
SSDB
Motif
Pfam: MHC_I C1-set MHC_I_C Marek_A ig PRD1_DD C2-set_2 Ig_2 Psg1 ASFV_J13L
Other DBs
NCBI-GeneID: 110287649
NCBI-ProteinID: XP_021009870
LinkDB
Position
Unknown
AA seq 374 aa
MGAMAPRTLLLLLAAALAPTQTRAGPHSLRYFYTAVSRPGLREPRFISVGYVDNTEFVRF
DSDAENPRMEPRARWMEQEGPGYWEEQTQIAKGNEQSFRVSLRNLLGYYNQSAGGSHTIQ
AMYGCEVGSDGRLLRGYEQSAYDGSDYIALNEDLKTWTAADTAAQISRRKWEQAGEAERH
RAYLEGTCVEWLRRYLERGNATLLRTDSPKAHVTHHPRSEVEITLRCWALGFYPADITLT
WQLNGEELTQDMELVETRPSGDGTFQKWASVVVPLGKEQNYTCHVYHEGLPEPLTLRWEP
PPSTDSYMVIIAVLGAVIIIIVAVVAFMMKRRRNTAFLLTGGKGGNYALAPGSQTSDESL
PDCKVMVQDPHSLP
NT seq 1125 nt   +upstreamnt  +downstreamnt
atgggggcgatggcgccgcgcacgctgctcctgctgctggcggccgccctggcccctact
cagacccgagcgggcccacactcgctgaggtatttctacaccgccgtgtcccggccgggc
ctccgggagccccggttcatctctgtcggctacgtggacaacacggagttcgtgcgcttc
gacagcgacgcggagaatccgaggatggagccgcgggcgcggtggatggagcaggagggg
ccggggtattgggaggagcagacacagatcgctaagggcaatgagcagagtttccgagtg
agcctgaggaacctgctcggctactacaaccagagcgcgggcggctctcacacgatccag
gcgatgtatggctgtgaggtggggtccgacgggcgcctcctccgcgggtatgagcagtcc
gcatacgacggcagcgattacatcgccctgaacgaagacctgaaaacgtggacggcggcg
gacacggcggcgcagatctcccgacgcaagtgggagcaggctggtgaagcagagagacac
agggcctacctggagggcacgtgcgtggagtggctccgcagatacctggagcgcgggaat
gcgacgctgctgcgcacagattccccaaaggcacatgtgacccatcaccccagatctgaa
gttgaaatcactctgaggtgctgggccctgggcttctaccctgctgacatcaccctgacc
tggcagttgaatggggaggagctgacccaggacatggagcttgtggagaccaggccttca
ggagatggaaccttccagaagtgggcatctgtggtggtgcctcttgggaaggagcagaat
tacacatgccatgtgtaccatgaggggctgccagagcccctcaccctgagatgggagcct
cctccatccactgactcttacatggtgatcattgctgtccttggagctgtgatcatcatc
attgttgctgtggtggcttttatgatgaagaggaggagaaacacagcttttcttctcaca
ggtggaaaaggagggaactatgctctggctccaggctcccagacctctgatgagtctctc
ccagattgtaaagtgatggttcaagaccctcattctctaccatga

KEGG   Mus caroli (Ryukyu mouse): 110287664
Entry
110287664         CDS       T05910                                 

Definition
(RefSeq) HLA class I histocompatibility antigen, A-25 alpha chain-like
  KO
K06751  MHC class I antigen
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04144  Endocytosis
mcal04145  Phagosome
mcal04218  Cellular senescence
mcal04514  Cell adhesion molecules
mcal04612  Antigen processing and presentation
mcal04940  Type I diabetes mellitus
mcal05163  Human cytomegalovirus infection
mcal05165  Human papillomavirus infection
mcal05166  Human T-cell leukemia virus 1 infection
mcal05167  Kaposi sarcoma-associated herpesvirus infection
mcal05168  Herpes simplex virus 1 infection
mcal05169  Epstein-Barr virus infection
mcal05170  Human immunodeficiency virus 1 infection
mcal05203  Viral carcinogenesis
mcal05320  Autoimmune thyroid disease
mcal05330  Allograft rejection
mcal05332  Graft-versus-host disease
mcal05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    110287664
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    110287664
   04145 Phagosome
    110287664
  09143 Cell growth and death
   04218 Cellular senescence
    110287664
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    110287664
   04612 Antigen processing and presentation
    110287664
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    110287664
  09163 Immune disease
   05320 Autoimmune thyroid disease
    110287664
   05330 Allograft rejection
    110287664
   05332 Graft-versus-host disease
    110287664
  09166 Cardiovascular disease
   05416 Viral myocarditis
    110287664
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    110287664
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110287664
   05170 Human immunodeficiency virus 1 infection
    110287664
   05168 Herpes simplex virus 1 infection
    110287664
   05163 Human cytomegalovirus infection
    110287664
   05167 Kaposi sarcoma-associated herpesvirus infection
    110287664
   05169 Epstein-Barr virus infection
    110287664
   05165 Human papillomavirus infection
    110287664
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcal04147]
    110287664
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mcal00537]
    110287664
Exosome [BR:mcal04147]
 Exosomal proteins
  Proteins found in most exosomes
   110287664
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mcal00537]
 Antigens
  110287664
SSDB
Motif
Pfam: MHC_I C1-set Ig_3 ig Rio2_N Ig_2
Other DBs
NCBI-GeneID: 110287664
NCBI-ProteinID: XP_021009886
UniProt: A0A6P5P4U4
LinkDB
Position
Unknown
AA seq 330 aa
MRNPGCCTLLLLLVAMDLNQYCAGSHWLQTFNIAFLEPGMINSRFIHISYVDSIQYQGFD
SKEPMATLKPRAAWMEQELPKYWNVETTKVLLLSQIERRILYFMIEKYEHRMDDYHTLQE
VYGCNVANDGRFLHGHFRLTYYGYDYLTLNEDLSSWTAEGKGAEYMKSRWENMSEAKRWK
TYLQGECVQRLLRYLDLGKETLLRSDAPQTHGTHHVRPEGNVTLRCWALRFYPADITMTW
KRDRNNHTQDMELPDTRPAGDGTFQKWAAVVVPSGEELRYTCHVHHEGLPEPLTLKWEPP
QTIPIIAILIGLVLGTLVVGSVVIFLVWKK
NT seq 993 nt   +upstreamnt  +downstreamnt
atgaggaaccctggatgctgcacactcctcctcctcttggtggccatggacctgaaccag
tattgtgcaggctcacactggctgcagactttcaacattgcatttttggagcctggcatg
attaattcccggttcatccacatcagctatgtagactctatacagtatcagggatttgac
agcaaagaaccaatggctactttaaaacctcgggctgcatggatggagcaggaactacct
aaatattggaacgtggagacaacaaaagttctgctcttgtcacagatagaaagacgaatt
ctttacttcatgatcgaaaaatatgaacacagaatggacgattatcacaccctgcaggaa
gtatatggctgcaatgtggctaatgatgggcgcttccttcatggtcacttccggctcacc
tactatggctatgattacttaaccctgaatgaggacctgagctcctggactgcagagggc
aagggagctgaatacatgaagagcaggtgggagaatatgagtgaggcaaaaaggtggaag
acttacctgcaaggggagtgtgtacaaaggcttcttagatacctggaccttggaaaggag
actttgctgcgctctgatgccccccaaacacatgggacccaccatgtaagacctgaaggg
aatgtcaccctgaggtgttgggccctgagattctacccagctgatatcaccatgacctgg
aagagggataggaacaaccacacccaggacatggagctgccagacaccaggcctgcaggg
gatggaaccttccagaagtgggcagctgtggtggttccttctggagaagagctaagatac
acatgtcatgtgcaccatgaagggttacctgagcctctcactctgaaatgggagcctcca
caaaccatccccataatagcaattctcatcggcctggttcttggaactttggtggtggga
tctgtggtcatttttctggtgtggaagaaataa

KEGG   Mus caroli (Ryukyu mouse): 110287975
Entry
110287975         CDS       T05910                                 

Definition
(RefSeq) class I histocompatibility antigen, Gogo-A*0501 alpha chain-like isoform X1
  KO
K06751  MHC class I antigen
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04144  Endocytosis
mcal04145  Phagosome
mcal04218  Cellular senescence
mcal04514  Cell adhesion molecules
mcal04612  Antigen processing and presentation
mcal04940  Type I diabetes mellitus
mcal05163  Human cytomegalovirus infection
mcal05165  Human papillomavirus infection
mcal05166  Human T-cell leukemia virus 1 infection
mcal05167  Kaposi sarcoma-associated herpesvirus infection
mcal05168  Herpes simplex virus 1 infection
mcal05169  Epstein-Barr virus infection
mcal05170  Human immunodeficiency virus 1 infection
mcal05203  Viral carcinogenesis
mcal05320  Autoimmune thyroid disease
mcal05330  Allograft rejection
mcal05332  Graft-versus-host disease
mcal05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    110287975
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    110287975
   04145 Phagosome
    110287975
  09143 Cell growth and death
   04218 Cellular senescence
    110287975
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    110287975
   04612 Antigen processing and presentation
    110287975
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    110287975
  09163 Immune disease
   05320 Autoimmune thyroid disease
    110287975
   05330 Allograft rejection
    110287975
   05332 Graft-versus-host disease
    110287975
  09166 Cardiovascular disease
   05416 Viral myocarditis
    110287975
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    110287975
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110287975
   05170 Human immunodeficiency virus 1 infection
    110287975
   05168 Herpes simplex virus 1 infection
    110287975
   05163 Human cytomegalovirus infection
    110287975
   05167 Kaposi sarcoma-associated herpesvirus infection
    110287975
   05169 Epstein-Barr virus infection
    110287975
   05165 Human papillomavirus infection
    110287975
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcal04147]
    110287975
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mcal00537]
    110287975
Exosome [BR:mcal04147]
 Exosomal proteins
  Proteins found in most exosomes
   110287975
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mcal00537]
 Antigens
  110287975
SSDB
Motif
Pfam: MHC_I C1-set ig C2-set_2 Ilm1 Ig_2
Other DBs
NCBI-GeneID: 110287975
NCBI-ProteinID: XP_021010106
UniProt: A0A6P5P7J7
LinkDB
Position
Unknown
AA seq 342 aa
MKNFESQPLLLLFMVTLVIAKHSNGSHTLRFVSTFFSWPRHLDPQFILLIYVDETLIMGF
NSISESQRMESRVPWLNELNAEFWEFATQGALKEKNLMAEIMNKLLHIYNDSMAGYHIIQ
ETYGCQVKQRMYFSHAFMELVLDTHDYITLNEDLQTWRAVGKAAEILKEVFEKVNLVKSS
RSFLLGACVEGLLHYLNFGKKYLLRTDTPKIHMTYKIRPDRKITLRCWAFNFYPSEITLT
WQRDGSNQTQDMEVVETRPSGDGTFQKWAAVVVSSGEEHRYTCHVNHEGLSEPVTLRWDP
PEPTIPFMPMIIALVLGALLMGAVMTFLIWKRRTRGKKGSWS
NT seq 1029 nt   +upstreamnt  +downstreamnt
atgaagaactttgaatcccagcctctcctcttgctgttcatggtcaccttggtcattgca
aagcattcaaatggttcacacactctgagatttgtgtccaccttcttctcatggcctcgg
catctggatccgcagtttatccttctcatctatgtggatgaaacactgatcatgggattc
aacagtatatcagagagtcagaggatggagagtcgggtaccatggttgaatgagctaaat
gcagagttttgggagtttgcaacacagggtgccctgaaagaaaaaaacttgatggcagaa
attatgaacaaattgcttcacatctacaatgatagcatggctggatatcacataatccag
gaaacgtatggctgccaagtcaagcagagaatgtacttcagtcacgccttcatggaatta
gtattagatacacatgattacatcacactgaatgaggatctgcaaacatggagagcggtt
ggcaaggcagctgagatacttaaggaagtgtttgagaaagtaaatcttgtaaagtcatcg
aggtctttcctgctgggtgcatgtgtggaggggctccttcactacctgaactttgggaag
aagtatttgctgagaacagacacccctaaaatacacatgacctataagatcagaccagat
aggaaaatcaccctgaggtgctgggccttcaacttctacccatctgaaatcaccctaacc
tggcagagggatggaagcaaccagacccaggacatggaggtggtagagaccaggccttct
ggtgatggaacttttcagaaatgggcagctgtggtggtctcttctggagaagagcataga
tacacatgccatgtaaatcatgagggtctatctgagcctgtcaccctgagatgggatcct
cctgaacccaccatccccttcatgcctatgattattgctctggttcttggggctctgctt
atgggagcagtgatgacttttcttatatggaagagaaggactagaggtaagaaagggtca
tggtcttaa

KEGG   Mus caroli (Ryukyu mouse): 110288427
Entry
110288427         CDS       T05910                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: H-2 class I histocompatibility antigen, K-B alpha chain-like
  KO
K06751  MHC class I antigen
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04144  Endocytosis
mcal04145  Phagosome
mcal04218  Cellular senescence
mcal04514  Cell adhesion molecules
mcal04612  Antigen processing and presentation
mcal04940  Type I diabetes mellitus
mcal05163  Human cytomegalovirus infection
mcal05165  Human papillomavirus infection
mcal05166  Human T-cell leukemia virus 1 infection
mcal05167  Kaposi sarcoma-associated herpesvirus infection
mcal05168  Herpes simplex virus 1 infection
mcal05169  Epstein-Barr virus infection
mcal05170  Human immunodeficiency virus 1 infection
mcal05203  Viral carcinogenesis
mcal05320  Autoimmune thyroid disease
mcal05330  Allograft rejection
mcal05332  Graft-versus-host disease
mcal05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    110288427
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    110288427
   04145 Phagosome
    110288427
  09143 Cell growth and death
   04218 Cellular senescence
    110288427
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    110288427
   04612 Antigen processing and presentation
    110288427
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    110288427
  09163 Immune disease
   05320 Autoimmune thyroid disease
    110288427
   05330 Allograft rejection
    110288427
   05332 Graft-versus-host disease
    110288427
  09166 Cardiovascular disease
   05416 Viral myocarditis
    110288427
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    110288427
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110288427
   05170 Human immunodeficiency virus 1 infection
    110288427
   05168 Herpes simplex virus 1 infection
    110288427
   05163 Human cytomegalovirus infection
    110288427
   05167 Kaposi sarcoma-associated herpesvirus infection
    110288427
   05169 Epstein-Barr virus infection
    110288427
   05165 Human papillomavirus infection
    110288427
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcal04147]
    110288427
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mcal00537]
    110288427
Exosome [BR:mcal04147]
 Exosomal proteins
  Proteins found in most exosomes
   110288427
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mcal00537]
 Antigens
  110288427
SSDB
Motif
Pfam: MHC_I C1-set MHC_I_C Ig_3 ig C2-set_2 Ig_2
Other DBs
NCBI-GeneID: 110288427
NCBI-ProteinID: XP_021010440
LinkDB
Position
Unknown
AA seq 359 aa
MVPTMLLLLVAVAQTLIEIRAGPHSLRYFYTAVSRPGLGEPRFIIVGYVDDTQFVRFDSD
AENPRYEPRARWMEQEGPEYWEEQTQIAKGNEQVFXVSLRNLLGYYNQSAGGSHTIQRMY
GCEVGSDGRLLLGYQQFAYDGRDYIALNEDLKTWTAADMAAQITRRKWEQAGAAERSKVY
LEGACVESLRRYLELGNATLLRTDPPKAHVTHHPRSEGEVTLRCWALGFYPADITLTWQL
NGEELTQDMELVKTRPAGDGTFQKWAAVVVPLGKEQNYTCHVYHEGLPEPLTLRWEPPPS
TVSNMATIAVLVVLGAXAITGAVVAFVMKRRRNTGGQGGDYAPAPGSQSSDMSLPDCKA
NT seq 1080 nt   +upstreamnt  +downstreamnt
atggtgccaacaatgctgctcctgctggtggcggtcgcccagaccctgatcgagatccgc
gcgggcccacactcgctgcgatatttctacaccgccgtgtcccggcccggcctcggggag
ccccggttcattatcgtcggctacgtggacgacacgcagttcgtgcgcttcgacagcgac
gctgagaatccgagatatgagccgcgggcgcgatggatggagcaggaggggccggagtat
tgggaggagcagacacagatcgctaagggcaatgagcaggttttctgagtgagcctgagg
aacctgctcggctactacaaccagagcgcgggcggctctcacacgatccagcggatgtac
ggctgtgaagtggggtccgacgggcgcctcctcctcgggtaccagcagttcgcctacgac
ggccgcgattacatcgccctgaacgaagacctgaaaacgtggacggcggcggacatggca
gcgcagataacccgtcgcaagtgggagcaggctggtgctgcagagagaagcaaggtctac
ctggagggcgcgtgcgtggaatcgctccgcagatacctggagctcgggaatgcgacgctg
ctgcgcacagatcctccaaaggcccatgtgacccatcaccccagatctgaaggtgaagtc
accctgaggtgctgggccctgggcttctaccctgctgacatcaccctgacctggcagttg
aatggggaggagctgacccaggacatggagcttgtgaagaccaggcctgcaggggatgga
accttccagaagtgggcagctgtggtggtgcctcttgggaaggagcagaattacacatgc
catgtgtaccatgaggggctgcctgagcccctcaccctgagatgggagcctcctccatcc
actgtctccaacatggcgaccattgctgttctggttgtccttggagctntggccatcact
ggagctgtggtggcttttgtgatgaagaggaggagaaacacaggtggacaaggaggtgac
tatgctccagctccaggctcccagagctctgatatgtctctcccagattgtaaagcatga

KEGG   Mus caroli (Ryukyu mouse): 110288489
Entry
110288489         CDS       T05910                                 

Definition
(RefSeq) H-2 class I histocompatibility antigen, D-K alpha chain-like
  KO
K06751  MHC class I antigen
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04144  Endocytosis
mcal04145  Phagosome
mcal04218  Cellular senescence
mcal04514  Cell adhesion molecules
mcal04612  Antigen processing and presentation
mcal04940  Type I diabetes mellitus
mcal05163  Human cytomegalovirus infection
mcal05165  Human papillomavirus infection
mcal05166  Human T-cell leukemia virus 1 infection
mcal05167  Kaposi sarcoma-associated herpesvirus infection
mcal05168  Herpes simplex virus 1 infection
mcal05169  Epstein-Barr virus infection
mcal05170  Human immunodeficiency virus 1 infection
mcal05203  Viral carcinogenesis
mcal05320  Autoimmune thyroid disease
mcal05330  Allograft rejection
mcal05332  Graft-versus-host disease
mcal05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    110288489
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    110288489
   04145 Phagosome
    110288489
  09143 Cell growth and death
   04218 Cellular senescence
    110288489
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    110288489
   04612 Antigen processing and presentation
    110288489
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    110288489
  09163 Immune disease
   05320 Autoimmune thyroid disease
    110288489
   05330 Allograft rejection
    110288489
   05332 Graft-versus-host disease
    110288489
  09166 Cardiovascular disease
   05416 Viral myocarditis
    110288489
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    110288489
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110288489
   05170 Human immunodeficiency virus 1 infection
    110288489
   05168 Herpes simplex virus 1 infection
    110288489
   05163 Human cytomegalovirus infection
    110288489
   05167 Kaposi sarcoma-associated herpesvirus infection
    110288489
   05169 Epstein-Barr virus infection
    110288489
   05165 Human papillomavirus infection
    110288489
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcal04147]
    110288489
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mcal00537]
    110288489
Exosome [BR:mcal04147]
 Exosomal proteins
  Proteins found in most exosomes
   110288489
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mcal00537]
 Antigens
  110288489
SSDB
Motif
Pfam: MHC_I
Other DBs
NCBI-GeneID: 110288489
NCBI-ProteinID: XP_021010481
UniProt: A0A6P5PC98
LinkDB
Position
Unknown
AA seq 220 aa
MAWRTVLLLLAAALAPTQTCAAMSRPGLGEPRFIAVGYVDDTQFVSFDSAAENPRMEPRA
PWMEQEEPEYWERETRIAKNTEQISRVNLRTLSGYYNQSEGGSHTYQRMSGCDVGSDRRL
LRGYWQYAYDGQDYIALNEDLKTWTTADITAQITKQKLEQAGAAERERAYLEGECVEWLR
RYLELGNATLLRTGAGAAGSSSLCPRAGAQSWGRRNPQLG
NT seq 663 nt   +upstreamnt  +downstreamnt
atggcttggcgcacagtgctcctgctgctggcggccgccctggccccgactcagacctgt
gcggccatgtcccggcctggcctcggggagccccggttcatcgctgttggctacgtggac
gacacgcagttcgtgagcttcgacagcgccgcggagaatccgaggatggagccgcgcgcg
ccatggatggagcaggaggagcctgagtattgggagcgggagacacggatcgccaagaac
acggagcagatttctcgagtgaacctgaggactctgagcggctactacaaccagagcgag
ggcggctctcacacttaccagcggatgtctggctgtgatgtggggtccgaccggcgcctc
ctccgtgggtactggcagtatgcatacgacggccaggattacatcgccctgaatgaagac
ctgaaaacgtggacgacagcagacataacagctcagattaccaaacaaaaactggagcag
gctggtgctgcagaaagagagagggcctacctggagggcgagtgcgtggagtggctccgc
agatacctggagctcgggaatgcgacgctgctgcgcacaggtgcaggggccgcgggcagc
tcctccctctgccctcgggctggggctcagtcctggggaagaagaaaccctcagctgggg
tga

KEGG   Mus caroli (Ryukyu mouse): 110288539
Entry
110288539         CDS       T05910                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: H-2 class I histocompatibility antigen, Q10 alpha chain-like
  KO
K06751  MHC class I antigen
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04144  Endocytosis
mcal04145  Phagosome
mcal04218  Cellular senescence
mcal04514  Cell adhesion molecules
mcal04612  Antigen processing and presentation
mcal04940  Type I diabetes mellitus
mcal05163  Human cytomegalovirus infection
mcal05165  Human papillomavirus infection
mcal05166  Human T-cell leukemia virus 1 infection
mcal05167  Kaposi sarcoma-associated herpesvirus infection
mcal05168  Herpes simplex virus 1 infection
mcal05169  Epstein-Barr virus infection
mcal05170  Human immunodeficiency virus 1 infection
mcal05203  Viral carcinogenesis
mcal05320  Autoimmune thyroid disease
mcal05330  Allograft rejection
mcal05332  Graft-versus-host disease
mcal05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    110288539
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    110288539
   04145 Phagosome
    110288539
  09143 Cell growth and death
   04218 Cellular senescence
    110288539
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    110288539
   04612 Antigen processing and presentation
    110288539
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    110288539
  09163 Immune disease
   05320 Autoimmune thyroid disease
    110288539
   05330 Allograft rejection
    110288539
   05332 Graft-versus-host disease
    110288539
  09166 Cardiovascular disease
   05416 Viral myocarditis
    110288539
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    110288539
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110288539
   05170 Human immunodeficiency virus 1 infection
    110288539
   05168 Herpes simplex virus 1 infection
    110288539
   05163 Human cytomegalovirus infection
    110288539
   05167 Kaposi sarcoma-associated herpesvirus infection
    110288539
   05169 Epstein-Barr virus infection
    110288539
   05165 Human papillomavirus infection
    110288539
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcal04147]
    110288539
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mcal00537]
    110288539
Exosome [BR:mcal04147]
 Exosomal proteins
  Proteins found in most exosomes
   110288539
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mcal00537]
 Antigens
  110288539
SSDB
Motif
Pfam: MHC_I C1-set Ig_3 ig MHC_I_3 Ig_2 C2-set_2
Other DBs
NCBI-GeneID: 110288539
NCBI-ProteinID: XP_021010515
LinkDB
Position
Unknown
AA seq 333 aa
MGAMAPRTLLLLLAAALAPTQTRAGPHSMRYFETAVSRPGLGKPRFIIVGYVDDTQFVRF
DSDAEIQRMEPRALWMEQEEPEYWERETQKAKRSEQSFRVNLRTLLSYYNQSVSGSHTLQ
WMYGCDVGSDGRLLRGYLQYAYDGRDYIALNEDLKTWTAADMAAMITRRKWEQAGDAEYY
RAYLEGTCVEWLRRYLERGNATLLRTDPPKTHVTHHPGSEGDVTLRCWALGFYPADITLT
WQLNGEELTQDMELVETRPAGDGTFQKWASVVVPLGKEQNYTCHVEHEGLPEPLSLRWEP
PPSTGSIIADXAVAVIEALVAFVMKRRRNTGSM
NT seq 1002 nt   +upstreamnt  +downstreamnt
atgggggcgatggcgccgcgcacgctgctcctgctgctggcggctgccctggccccgacc
cagacccgcgcaggcccacactcgatgcggtatttcgagaccgccgtttcccggccgggc
cttgggaagccccggttcattatcgtcggttacgtggacgacacgcagttcgtgcgcttc
gatagcgacgcggagattcagaggatggagccgcgggcgctgtggatggagcaggaggag
ccggagtattgggagcgggagacacagaaagccaagcgcagtgagcagagtttccgagtg
aacctgagaaccctgctcagctactacaaccagagcgtgagcggctctcacacactccag
tggatgtatggctgtgacgtggggtccgacgggcgcctcctccgcgggtacctgcagtac
gcatacgacggccgcgattacattgccctgaacgaagacctgaaaacgtggacagcggcg
gacatggcggcgatgatcacccgacgcaagtgggagcaggctggtgatgcagagtattac
agggcctacctggagggcacatgcgtggagtggctccgcagatacctggagcgcgggaat
gcgacgctgctgcgcacagatcccccaaagacacatgtgacccatcacccgggatctgaa
ggtgatgtcaccctgaggtgctgggccctgggcttctaccctgctgacatcaccctgacc
tggcagttgaatggggaggaactgacccaggacatggagcttgtggagaccaggcctgca
ggggatggaaccttccagaagtgggcatctgtggtggtgcctcttgggaaggagcagaat
tacacatgccatgtggaacatgaggggctgcctgagcccctctccctgagatgggagcct
cctccatccactggctccatcattgctgatnctgctgtggccgtcattgaagctctggta
gcttttgtgatgaagagaaggagaaacacaggctcaatgtga

KEGG   Mus caroli (Ryukyu mouse): 110288607
Entry
110288607         CDS       T05910                                 

Definition
(RefSeq) HLA class I histocompatibility antigen, A-32 alpha chain-like
  KO
K06751  MHC class I antigen
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04144  Endocytosis
mcal04145  Phagosome
mcal04218  Cellular senescence
mcal04514  Cell adhesion molecules
mcal04612  Antigen processing and presentation
mcal04940  Type I diabetes mellitus
mcal05163  Human cytomegalovirus infection
mcal05165  Human papillomavirus infection
mcal05166  Human T-cell leukemia virus 1 infection
mcal05167  Kaposi sarcoma-associated herpesvirus infection
mcal05168  Herpes simplex virus 1 infection
mcal05169  Epstein-Barr virus infection
mcal05170  Human immunodeficiency virus 1 infection
mcal05203  Viral carcinogenesis
mcal05320  Autoimmune thyroid disease
mcal05330  Allograft rejection
mcal05332  Graft-versus-host disease
mcal05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    110288607
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    110288607
   04145 Phagosome
    110288607
  09143 Cell growth and death
   04218 Cellular senescence
    110288607
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    110288607
   04612 Antigen processing and presentation
    110288607
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    110288607
  09163 Immune disease
   05320 Autoimmune thyroid disease
    110288607
   05330 Allograft rejection
    110288607
   05332 Graft-versus-host disease
    110288607
  09166 Cardiovascular disease
   05416 Viral myocarditis
    110288607
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    110288607
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110288607
   05170 Human immunodeficiency virus 1 infection
    110288607
   05168 Herpes simplex virus 1 infection
    110288607
   05163 Human cytomegalovirus infection
    110288607
   05167 Kaposi sarcoma-associated herpesvirus infection
    110288607
   05169 Epstein-Barr virus infection
    110288607
   05165 Human papillomavirus infection
    110288607
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcal04147]
    110288607
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mcal00537]
    110288607
Exosome [BR:mcal04147]
 Exosomal proteins
  Proteins found in most exosomes
   110288607
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mcal00537]
 Antigens
  110288607
SSDB
Motif
Pfam: MHC_I C1-set ig Ig_3 C2-set_2 Ig_2 Psg1
Other DBs
NCBI-GeneID: 110288607
NCBI-ProteinID: XP_021010566
UniProt: A0A6P5P8P7
LinkDB
Position
Unknown
AA seq 344 aa
MKNFESQPLLLLLMVTLAITKHPNGSHTLRYVYTLLSWPGPLEPQLIFLGYVDDTQIMGF
NSIRENLGVESREPWMYETGAFWAKTTDDVVKEQHILKEIMRNVLHIYNYSIIGYHTIQK
TYGCQVMHRRYLSHGFFELAFNLHDYITLNEDLRTWRGVGKAGEMLKEMWEKTNYVNQVK
PFLQITCVNLLLRFLTFGKKSLLRTDAPKIHMTHKIRPDRKITLRCWAFNFYPSEITLTW
QRDGSNQTQDMEVIETRPSGNGTFQKWAAVVVSSGEEHRYTCHVNHEGLSEPITIRWAKH
EPPEPTIPFMPMIIALVLGALLMGSVMTFLIWKRRTRGKKGSWS
NT seq 1035 nt   +upstreamnt  +downstreamnt
atgaagaactttgaatcccagcctctcctcctgctgctcatggtcaccttagccatcacg
aagcatccaaatggttcacacactctgagatatgtatataccctcctgtcatggcctgga
cctctggagccacagttaatctttctcggctatgtggatgatacacagatcatgggattc
aacagtataagagagaatctgggggtggagagccgggaaccatggatgtatgagactgga
gcgttttgggcaaagacaacagatgatgttgtgaaagaacaacatatcttgaaagaaata
atgaggaatgtgctacatatctacaattatagcatcattggatatcacacaatccagaag
acttatggctgccaagtcatgcacagacggtacttaagtcatggcttctttgaattagca
ttcaatctccatgattacatcacactgaatgaggatctgaggacatggaggggagttggc
aaggcaggtgagatgcttaaggaaatgtgggagaaaacaaactatgtaaaccaggtgaag
cctttcctgcagattacatgtgtgaacttactccttcgattcctgacctttgggaagaag
agtttgctgagaacagacgcccctaaaatacacatgacccataagatcagaccagatagg
aaaatcaccttgaggtgctgggccttcaacttttacccatctgaaatcactttaacctgg
cagagggatggaagcaaccagacccaggacatggaggtgatagagaccaggccttctggt
aatggaactttccagaagtgggcagctgtggtggtctcttctggagaagagcatagatac
acatgccatgtaaatcatgaggggctatctgagcccatcaccatcagatgggctaagcat
gagcctcctgagcccaccatccccttcatgcctatgattattgctctggttcttggagct
ctccttatgggatcagtgatgacttttcttatatggaagagaaggactagaggtaagaaa
gggtcatggtcttaa

KEGG   Mus caroli (Ryukyu mouse): 110288635
Entry
110288635         CDS       T05910                                 

Definition
(RefSeq) H-2 class I histocompatibility antigen, Q7 alpha chain-like isoform X1
  KO
K06751  MHC class I antigen
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04144  Endocytosis
mcal04145  Phagosome
mcal04218  Cellular senescence
mcal04514  Cell adhesion molecules
mcal04612  Antigen processing and presentation
mcal04940  Type I diabetes mellitus
mcal05163  Human cytomegalovirus infection
mcal05165  Human papillomavirus infection
mcal05166  Human T-cell leukemia virus 1 infection
mcal05167  Kaposi sarcoma-associated herpesvirus infection
mcal05168  Herpes simplex virus 1 infection
mcal05169  Epstein-Barr virus infection
mcal05170  Human immunodeficiency virus 1 infection
mcal05203  Viral carcinogenesis
mcal05320  Autoimmune thyroid disease
mcal05330  Allograft rejection
mcal05332  Graft-versus-host disease
mcal05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    110288635
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    110288635
   04145 Phagosome
    110288635
  09143 Cell growth and death
   04218 Cellular senescence
    110288635
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    110288635
   04612 Antigen processing and presentation
    110288635
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    110288635
  09163 Immune disease
   05320 Autoimmune thyroid disease
    110288635
   05330 Allograft rejection
    110288635
   05332 Graft-versus-host disease
    110288635
  09166 Cardiovascular disease
   05416 Viral myocarditis
    110288635
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    110288635
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110288635
   05170 Human immunodeficiency virus 1 infection
    110288635
   05168 Herpes simplex virus 1 infection
    110288635
   05163 Human cytomegalovirus infection
    110288635
   05167 Kaposi sarcoma-associated herpesvirus infection
    110288635
   05169 Epstein-Barr virus infection
    110288635
   05165 Human papillomavirus infection
    110288635
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcal04147]
    110288635
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mcal00537]
    110288635
Exosome [BR:mcal04147]
 Exosomal proteins
  Proteins found in most exosomes
   110288635
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mcal00537]
 Antigens
  110288635
SSDB
Motif
Pfam: MHC_I C1-set Ig_3 Marek_A ig C2-set_2 Ig_2 Psg1 ATG22 DFF40 DUF3377
Other DBs
NCBI-GeneID: 110288635
NCBI-ProteinID: XP_021010591
UniProt: A0A6P5P6S9
LinkDB
Position
Unknown
AA seq 378 aa
MWAMAPCTLLLLLAATLTLTQTRAGSHSLRYFYTAMSRPNFEKPRFISVGYVDDTQFQRF
DSAAKNARAESCAPWMVEKLEYWEEQTKSAKTNKQWFRGSLRTALTYYNQSAGGSHTFQQ
MYGCDVGSDGRLLRGYWQLAYDGRDYIALNEDLKTWTAADRAARNTQSKWEQEGAAEYYE
DFLKGACVERLRGYLQKGKEMLLRTDPPKAHVTHHPRSKGEVTLRCWALGFYPADITLTW
QLNGEELTQDMEFVETRPAGDGTFQKWASVVVPLGKEQNYTCHVYHEGLPEPLTLRWEPP
PSTKTNTVIIAVVVVVVGAVAILGAVVVFVLKRRRNTGTAPRALMYLSQMVKVTLWGLIG
EGQCEYDWVSGTPRIPSE
NT seq 1137 nt   +upstreamnt  +downstreamnt
atgtgggctatggcaccgtgcacgctgctcctgctgctggcagccaccctgactctgacc
cagacccgcgctggctcacactcgctgcggtatttctacaccgccatgtcccggcccaac
ttcgagaagccccgattcatctctgtcggctacgtggacgacacgcagttccagcgcttc
gacagcgccgcgaagaatgcaagggcggagtcgtgcgcgccgtggatggtggagaagttg
gagtattgggaggagcagacaaagagcgccaaaaccaacaagcagtggttccgagggagc
ctgaggaccgcgctgacctactacaaccagagtgcaggcggctctcacaccttccagcag
atgtacggctgtgacgtggggtcggatgggcgcctcctccgcggttactggcagcttgcc
tacgacggccgcgattacatcgccctgaacgaagacctgaaaacgtggactgctgctgac
agggctgcgcggaacacccaaagcaagtgggagcaagaaggtgctgcagagtattatgag
gactttctgaaaggcgcatgcgtggagaggctccgcggatacctgcagaaggggaaggag
atgctgctgcgcacagatcccccaaaggcacatgtaacccatcaccccagatctaaaggt
gaagtcaccctgaggtgctgggccctgggcttctaccctgctgacatcaccctgacctgg
cagttgaatggggaggagctgacccaggacatggagtttgtggagaccaggcctgcaggg
gatggaaccttccagaagtgggcatctgtggtggtgcctcttgggaaggagcagaattac
acatgccatgtgtaccatgaggggctgcctgagcccctcaccctgagatgggagcctcct
ccatccaccaagactaacacggtaatcattgctgttgtggttgttgtggttggagctgtg
gccatccttggagctgtggtggtttttgtgctgaagaggaggagaaacacagggacagct
cctagagctctgatgtatctctcccagatggtaaaggtgacactctggggcctgattggg
gaggggcaatgtgaatatgattgggtttcagggactcccagaatcccctctgagtga

KEGG   Mus caroli (Ryukyu mouse): 110288692
Entry
110288692         CDS       T05910                                 

Definition
(RefSeq) H-2 class I histocompatibility antigen, Q7 alpha chain-like
  KO
K06751  MHC class I antigen
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04144  Endocytosis
mcal04145  Phagosome
mcal04218  Cellular senescence
mcal04514  Cell adhesion molecules
mcal04612  Antigen processing and presentation
mcal04940  Type I diabetes mellitus
mcal05163  Human cytomegalovirus infection
mcal05165  Human papillomavirus infection
mcal05166  Human T-cell leukemia virus 1 infection
mcal05167  Kaposi sarcoma-associated herpesvirus infection
mcal05168  Herpes simplex virus 1 infection
mcal05169  Epstein-Barr virus infection
mcal05170  Human immunodeficiency virus 1 infection
mcal05203  Viral carcinogenesis
mcal05320  Autoimmune thyroid disease
mcal05330  Allograft rejection
mcal05332  Graft-versus-host disease
mcal05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    110288692
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    110288692
   04145 Phagosome
    110288692
  09143 Cell growth and death
   04218 Cellular senescence
    110288692
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    110288692
   04612 Antigen processing and presentation
    110288692
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    110288692
  09163 Immune disease
   05320 Autoimmune thyroid disease
    110288692
   05330 Allograft rejection
    110288692
   05332 Graft-versus-host disease
    110288692
  09166 Cardiovascular disease
   05416 Viral myocarditis
    110288692
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    110288692
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110288692
   05170 Human immunodeficiency virus 1 infection
    110288692
   05168 Herpes simplex virus 1 infection
    110288692
   05163 Human cytomegalovirus infection
    110288692
   05167 Kaposi sarcoma-associated herpesvirus infection
    110288692
   05169 Epstein-Barr virus infection
    110288692
   05165 Human papillomavirus infection
    110288692
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcal04147]
    110288692
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mcal00537]
    110288692
Exosome [BR:mcal04147]
 Exosomal proteins
  Proteins found in most exosomes
   110288692
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mcal00537]
 Antigens
  110288692
SSDB
Motif
Pfam: MHC_I C1-set MHC_I_C Ig_3 C2-set_2 ig Marek_A Ig_2 SP_C-Propep Psg1 Insulin_TMD
Other DBs
NCBI-GeneID: 110288692
NCBI-ProteinID: XP_021010633
UniProt: A0A6P5P6W6
LinkDB
Position
Unknown
AA seq 365 aa
MGAMAPRMLLLLLAASLKLTETRAGSHSLRYFHTAVSRPGFREPRFIIVGYVDDTQFVRF
DSDAENPRMEPRAAWMEQEEPEYWERNTQIAKENEQSFRWSLRTALRYYNQSKGGSHTFQ
WLVGCDLGPDGSLLRGYEQSAYDGLDYLALNEDLITWTAADLAALKTRRKLELFELAEMR
RTYLEGECLNWLHRYLKFGNATLLRKDPPNAHVTHHPRSEGEVTLRCWALGFYPADITLT
WQLNGEELTQDMEFVETRPAGDGTFQKWASVVVPLGKEQKYTCHVEHEGLPEPLTLRWEP
PPYTVSNMVIIAVLVVVGAVIIIGAVVAFVMMRRRHTGGKVRDYAQDPGRDRPQSSDISL
LDCKA
NT seq 1098 nt   +upstreamnt  +downstreamnt
atgggggcaatggcgccgcgaatgctgctcctgctgctggcggcctcgctgaaactgact
gagacccgcgcgggctcacactcgctgcggtatttccacaccgccgtatcccggccgggc
ttcagggagccccgattcattatcgtcggctacgtggacgacacgcagttcgtgcgcttc
gacagcgacgcggagaatccgaggatggagccgcgggcggcctggatggagcaggaggag
ccggagtattgggagcggaacacgcagatcgccaaggaaaatgagcagagtttccgatgg
agcctgaggaccgcgctgcgctactacaaccagagcaagggcggctctcacaccttccag
tggttggttggctgtgacctgggaccagacgggagcctactccgagggtatgaacagtct
gcctacgatggcctcgattacctcgccctgaacgaggatctgataacgtggacagcggcg
gacctggcggcgctgaagacccgacgcaagttggagctgtttgaacttgcagagatgcgc
aggacctaccttgagggcgagtgcttgaactggctccacagatacctgaagttcgggaat
gcaactctgttgcgcaaagatcccccaaatgcacatgtaacccatcatcccagatctgaa
ggtgaagtcaccctgaggtgctgggccctaggcttctaccctgctgacatcaccctgacc
tggcagttgaatggggaggagttgacccaggacatggagtttgtggaaaccaggcctgca
ggggatggaaccttccagaagtgggcatctgtggtggtgcctcttgggaaggagcagaag
tacacatgccatgtggaacatgaggggctgcctgagcccctcaccctgagatgggagcct
cctccatacactgtctccaacatggtaatcattgctgttctggttgttgttggagctgtg
atcatcattggagctgtggtggcttttgtgatgatgaggaggagacacacaggtggaaaa
gtaagagactacgctcaggatccaggcagggacagaccccagagctctgatatctctctc
ctagattgtaaagcatga

KEGG   Mus caroli (Ryukyu mouse): 110288724
Entry
110288724         CDS       T05910                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: H-2 class I histocompatibility antigen, Q7 alpha chain-like
  KO
K06751  MHC class I antigen
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04144  Endocytosis
mcal04145  Phagosome
mcal04218  Cellular senescence
mcal04514  Cell adhesion molecules
mcal04612  Antigen processing and presentation
mcal04940  Type I diabetes mellitus
mcal05163  Human cytomegalovirus infection
mcal05165  Human papillomavirus infection
mcal05166  Human T-cell leukemia virus 1 infection
mcal05167  Kaposi sarcoma-associated herpesvirus infection
mcal05168  Herpes simplex virus 1 infection
mcal05169  Epstein-Barr virus infection
mcal05170  Human immunodeficiency virus 1 infection
mcal05203  Viral carcinogenesis
mcal05320  Autoimmune thyroid disease
mcal05330  Allograft rejection
mcal05332  Graft-versus-host disease
mcal05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    110288724
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    110288724
   04145 Phagosome
    110288724
  09143 Cell growth and death
   04218 Cellular senescence
    110288724
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    110288724
   04612 Antigen processing and presentation
    110288724
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    110288724
  09163 Immune disease
   05320 Autoimmune thyroid disease
    110288724
   05330 Allograft rejection
    110288724
   05332 Graft-versus-host disease
    110288724
  09166 Cardiovascular disease
   05416 Viral myocarditis
    110288724
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    110288724
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110288724
   05170 Human immunodeficiency virus 1 infection
    110288724
   05168 Herpes simplex virus 1 infection
    110288724
   05163 Human cytomegalovirus infection
    110288724
   05167 Kaposi sarcoma-associated herpesvirus infection
    110288724
   05169 Epstein-Barr virus infection
    110288724
   05165 Human papillomavirus infection
    110288724
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcal04147]
    110288724
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mcal00537]
    110288724
Exosome [BR:mcal04147]
 Exosomal proteins
  Proteins found in most exosomes
   110288724
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mcal00537]
 Antigens
  110288724
SSDB
Motif
Pfam: MHC_I C1-set Ig_3 ig Ig_2 C2-set_2
Other DBs
NCBI-GeneID: 110288724
NCBI-ProteinID: XP_021010650
LinkDB
Position
Unknown
AA seq 354 aa
MPCVSDGEMTLRMLLLLLAASLKLTETSSGSHTLRYFHTAVSRPGLREPRFIIVGYVDDM
QFVRFDSDAKNPRMEPRAPWMEQEGPEYWERXTRTAKGNEQSFRVSLRNLLSYYNQSAGG
SHTFQWLLGCDMGSDGSLLRGYEQTAYDGRDYLALNEDLKTWTAADLAALITRRKLEQDG
LAERRRAYLEGACVEWLRRYLELGKETLLRKDPPKAHVTHHPRSXXDVTLRCWALGFYPA
DITLTWQLNGEELTQDMELVETRPAGDGTFQKWASVVVPLGKEQNYTCYVYHEGLPEPLT
LRWEPPPFTVSNMVTIAVLVVLGAVIVTGAVVAFVMKRRRNTGGKGGAYAPAPG
NT seq 1065 nt   +upstreamnt  +downstreamnt
atgccttgtgtttcagatggagaaatgacgctgcgaatgctgctcctgctgctggcagcc
tccctgaaactgactgagaccagctcgggctcacacacgctgcggtatttccacaccgcc
gtgtcccggcccggcctcagggagccccggttcattatcgtcggctacgtggacgacatg
cagttcgtgcgcttcgacagcgacgcgaagaatccgaggatggagccgcgggcaccgtgg
atggagcaggaggggccggagtattgggagcggnnaacacgcacagccaagggcaacgag
cagagtttccgagtgagcctgaggaacctgctcagctactacaaccagagcgcgggcggc
tctcacactttccagtggttgttgggctgtgacatggggtcagatgggagcctcctccgc
gggtatgagcagaccgcctatgacggccgcgattacctagccctgaacgaagacctgaaa
acgtggacagcggcggacctagcagcgctgatcacccgacgcaagttggagcaggatggt
cttgcagagaggcgtagggcctacctggagggcgcgtgcgtggagtggctccgcagatac
ctggagctcgggaaggagacgctgctacgcaaagatcccccaaaggcacatgtgacccat
caccccagatctnanngtgatgtcaccctgaggtgctgggccctgggcttctaccctgct
gacatcaccctgacctggcagttgaatggggaggagctgacccaggacatggagcttgtg
gagaccaggcctgcaggggatggaaccttccagaagtgggcatctgtggtggtgcctctt
gggaaggagcagaattacacatgttatgtgtaccatgaggggctgcctgagcccctcacc
ctgagatgggagcctcctccattcactgtctcaaacatggtgaccattgctgttctggtt
gtccttggagctgtgatagtcactggagctgtggtggcttttgtgatgaagaggagaaga
aacacaggtggaaaaggaggggcctatgctccagctccaggttag

KEGG   Mus caroli (Ryukyu mouse): 110288817
Entry
110288817         CDS       T05910                                 

Definition
(RefSeq) HLA class I histocompatibility antigen, A-25 alpha chain-like
  KO
K06751  MHC class I antigen
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04144  Endocytosis
mcal04145  Phagosome
mcal04218  Cellular senescence
mcal04514  Cell adhesion molecules
mcal04612  Antigen processing and presentation
mcal04940  Type I diabetes mellitus
mcal05163  Human cytomegalovirus infection
mcal05165  Human papillomavirus infection
mcal05166  Human T-cell leukemia virus 1 infection
mcal05167  Kaposi sarcoma-associated herpesvirus infection
mcal05168  Herpes simplex virus 1 infection
mcal05169  Epstein-Barr virus infection
mcal05170  Human immunodeficiency virus 1 infection
mcal05203  Viral carcinogenesis
mcal05320  Autoimmune thyroid disease
mcal05330  Allograft rejection
mcal05332  Graft-versus-host disease
mcal05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    110288817
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    110288817
   04145 Phagosome
    110288817
  09143 Cell growth and death
   04218 Cellular senescence
    110288817
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    110288817
   04612 Antigen processing and presentation
    110288817
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    110288817
  09163 Immune disease
   05320 Autoimmune thyroid disease
    110288817
   05330 Allograft rejection
    110288817
   05332 Graft-versus-host disease
    110288817
  09166 Cardiovascular disease
   05416 Viral myocarditis
    110288817
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    110288817
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110288817
   05170 Human immunodeficiency virus 1 infection
    110288817
   05168 Herpes simplex virus 1 infection
    110288817
   05163 Human cytomegalovirus infection
    110288817
   05167 Kaposi sarcoma-associated herpesvirus infection
    110288817
   05169 Epstein-Barr virus infection
    110288817
   05165 Human papillomavirus infection
    110288817
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcal04147]
    110288817
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mcal00537]
    110288817
Exosome [BR:mcal04147]
 Exosomal proteins
  Proteins found in most exosomes
   110288817
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mcal00537]
 Antigens
  110288817
SSDB
Motif
Pfam: MHC_I C1-set Ig_3 ig Ig_2 C2-set_2
Other DBs
NCBI-GeneID: 110288817
NCBI-ProteinID: XP_021010722
UniProt: A0A6P5P964
LinkDB
Position
Unknown
AA seq 330 aa
MRNPGCCTLLLLLVAMDLNLYCAGSHWLQTFNAVIMEPGMINSRFIHIGYVDTIEYQRYD
SKEPIAVLLPRVSWMEQVPLSYWTSETVGCAELSQVDRRILHFMVNKNEQRMDDYHTLQE
VYGCNVANDGSFLGGHFRLTYYGYDDLYLNENLSSWIAYGKAAEYVKSRWDGGGDAERWK
TYLQGVCVERLLRYMVLGKEALLRSDAPRTHVTHHVRPEGNVTLRCWALGFYPADITMTW
KRDGNNHTQDMELPDTRPAGDGTFQKWAAVVVPSGEELRYTCHVHHKGLSEPLKLKWVPP
HTIPIIAILIGLVLGTLVVGTVVIFLVWKK
NT seq 993 nt   +upstreamnt  +downstreamnt
atgaggaaccctggatgctgcacactcctcctcctcttggtggccatggatttgaacctg
tattgtgcaggctcacactggctgcagactttcaacgctgtaattatggagcctggcatg
attaattcccggttcatccacattggctatgtagacactatagagtatcagagatatgac
agcaaagaaccaattgcagttttgctacctcgggtttcatggatggagcaggtgccattg
tcatattggaccagtgagacagtaggctgtgcggaattgtcacaggtagacagacgaatt
cttcacttcatggtgaacaaaaatgaacaaagaatggacgattatcacaccctgcaggaa
gtgtatggctgcaatgtggctaatgatgggagcttcctcggtggtcacttccggctcacc
tactatggctacgatgacttatacctgaatgagaacctgagctcctggattgcatatgga
aaggcagctgaatatgtgaagagcaggtgggacggtggaggtgatgcagaaaggtggaag
acttacctgcaaggggtgtgcgtggaaaggcttcttagatacatggtccttggaaaggaa
gcattgctgcgctccgatgccccccgaacacatgtgacccaccatgtaagacctgaaggg
aatgtcaccctgaggtgctgggccctgggcttctacccagctgacatcaccatgacttgg
aagagggatgggaacaaccacacccaagacatggagctgccagacaccaggcctgcaggg
gatggaaccttccagaagtgggcagctgtggtggttccttctggagaagagctgagatat
acatgtcatgtgcaccataaagggttatctgagcctctcaagctgaaatgggtgcctcca
cacaccatccccatcatagcaattctcatcggcctggttcttggaactttggtggtggga
actgtggtaatttttctggtgtggaagaaataa

KEGG   Mus caroli (Ryukyu mouse): 110289160
Entry
110289160         CDS       T05910                                 

Definition
(RefSeq) H-2 class I histocompatibility antigen, K-K alpha chain-like
  KO
K06751  MHC class I antigen
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04144  Endocytosis
mcal04145  Phagosome
mcal04218  Cellular senescence
mcal04514  Cell adhesion molecules
mcal04612  Antigen processing and presentation
mcal04940  Type I diabetes mellitus
mcal05163  Human cytomegalovirus infection
mcal05165  Human papillomavirus infection
mcal05166  Human T-cell leukemia virus 1 infection
mcal05167  Kaposi sarcoma-associated herpesvirus infection
mcal05168  Herpes simplex virus 1 infection
mcal05169  Epstein-Barr virus infection
mcal05170  Human immunodeficiency virus 1 infection
mcal05203  Viral carcinogenesis
mcal05320  Autoimmune thyroid disease
mcal05330  Allograft rejection
mcal05332  Graft-versus-host disease
mcal05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    110289160
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    110289160
   04145 Phagosome
    110289160
  09143 Cell growth and death
   04218 Cellular senescence
    110289160
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    110289160
   04612 Antigen processing and presentation
    110289160
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    110289160
  09163 Immune disease
   05320 Autoimmune thyroid disease
    110289160
   05330 Allograft rejection
    110289160
   05332 Graft-versus-host disease
    110289160
  09166 Cardiovascular disease
   05416 Viral myocarditis
    110289160
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    110289160
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110289160
   05170 Human immunodeficiency virus 1 infection
    110289160
   05168 Herpes simplex virus 1 infection
    110289160
   05163 Human cytomegalovirus infection
    110289160
   05167 Kaposi sarcoma-associated herpesvirus infection
    110289160
   05169 Epstein-Barr virus infection
    110289160
   05165 Human papillomavirus infection
    110289160
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcal04147]
    110289160
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mcal00537]
    110289160
Exosome [BR:mcal04147]
 Exosomal proteins
  Proteins found in most exosomes
   110289160
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mcal00537]
 Antigens
  110289160
SSDB
Motif
Pfam: MHC_I MHC_I_C
Other DBs
NCBI-GeneID: 110289160
NCBI-ProteinID: XP_021010991
UniProt: A0A6P5P452
LinkDB
Position
Unknown
AA seq 277 aa
MAPRTLLLLLAAALAPTQTRASPHSLRYFYTAVSRPGLREPRFIIVGYVDDTQFVRFDSD
AENPRYEPRARWMEQEGPEYWEEETQIAKGNEQRFRVNLRTALRYYNQSAGDSHTIQRMS
GCEVGSDGRLLRGYEQFAYDGRDYIALNEDLKTWTAADMAAQITRRKWEQAGDAERYRAY
LEGECVEWLRRYLELGNATLLRTGPLTLRWEPPPSTDSNMVTIAVLIVLGAVIVIGAMVA
FLMKRRRDTGGKGGDYAPAPGREGSQTSDMSLPVCKA
NT seq 834 nt   +upstreamnt  +downstreamnt
atggcaccgcgcacgctgctcctgctgctggcggccgccctggccccgactcagacgcgc
gcgagcccacactcgctgcgatatttctacaccgccgtgtcccggcctggcctcagggag
ccccggttcattatcgtcggctacgtggacgacacgcagttcgtgcgcttcgacagcgac
gctgagaatccgagatatgagccgcgggcgcggtggatggagcaggaggggccggagtat
tgggaggaggagacacagatcgccaagggcaatgagcagagattccgagtgaacctgagg
accgcgctgcgctactacaaccagagcgcgggcgactctcacacgatccagcggatgtcc
ggctgtgaggtggggtcggacgggcgcctcctccgcgggtatgagcagttcgcatacgac
ggccgcgattacattgccctgaacgaagacctgaaaacgtggacggcggcggacatggcg
gcgcagatcacccgacgcaagtgggagcaggctggtgatgcagagagatacagggcctac
ctggagggcgagtgcgtggagtggctccgcagatacctggagctcgggaatgcgacgctg
ctgcgcacaggtcccctcaccctgagatgggagcctcctccatccactgactccaatatg
gtgaccattgctgttctgattgtccttggagctgtgatagtcattggagctatggtggct
tttttgatgaagaggaggagagacacaggtggaaaaggaggggactatgctccagctcca
ggcagagaaggctcccagacctctgatatgtctctcccagtttgtaaagcatga

KEGG   Mus caroli (Ryukyu mouse): 110312198
Entry
110312198         CDS       T05910                                 

Definition
(RefSeq) H-2 class I histocompatibility antigen, L-D alpha chain-like isoform X1
  KO
K06751  MHC class I antigen
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04144  Endocytosis
mcal04145  Phagosome
mcal04218  Cellular senescence
mcal04514  Cell adhesion molecules
mcal04612  Antigen processing and presentation
mcal04940  Type I diabetes mellitus
mcal05163  Human cytomegalovirus infection
mcal05165  Human papillomavirus infection
mcal05166  Human T-cell leukemia virus 1 infection
mcal05167  Kaposi sarcoma-associated herpesvirus infection
mcal05168  Herpes simplex virus 1 infection
mcal05169  Epstein-Barr virus infection
mcal05170  Human immunodeficiency virus 1 infection
mcal05203  Viral carcinogenesis
mcal05320  Autoimmune thyroid disease
mcal05330  Allograft rejection
mcal05332  Graft-versus-host disease
mcal05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    110312198
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    110312198
   04145 Phagosome
    110312198
  09143 Cell growth and death
   04218 Cellular senescence
    110312198
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    110312198
   04612 Antigen processing and presentation
    110312198
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    110312198
  09163 Immune disease
   05320 Autoimmune thyroid disease
    110312198
   05330 Allograft rejection
    110312198
   05332 Graft-versus-host disease
    110312198
  09166 Cardiovascular disease
   05416 Viral myocarditis
    110312198
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    110312198
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110312198
   05170 Human immunodeficiency virus 1 infection
    110312198
   05168 Herpes simplex virus 1 infection
    110312198
   05163 Human cytomegalovirus infection
    110312198
   05167 Kaposi sarcoma-associated herpesvirus infection
    110312198
   05169 Epstein-Barr virus infection
    110312198
   05165 Human papillomavirus infection
    110312198
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcal04147]
    110312198
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mcal00537]
    110312198
Exosome [BR:mcal04147]
 Exosomal proteins
  Proteins found in most exosomes
   110312198
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mcal00537]
 Antigens
  110312198
SSDB
Motif
Pfam: MHC_I C1-set MHC_I_C Ig_3 Insulin_TMD ig C2-set_2 Ig_2 Xylo_C
Other DBs
NCBI-GeneID: 110312198
NCBI-ProteinID: XP_021041405
Ensembl: MGP_CAROLIEiJ_G0021435
UniProt: A0A6P5R2C3
LinkDB
Position
17
AA seq 366 aa
MGAMAPRTLLLLLAAALAPTQTRAGPHSMRYFHTAVSRPGLGEPRFIAVGYVDDTQFVRF
DSDAENPRAEPRAPWMEQEGPEYWEEQTQIAKGNEQRFRVSLRNLLGYYNQSAGGSHTFQ
WMVGCDVGSDGRLLRGYWQSAYDGRDYIAMNEDLKTWTAADTAAQITRRKLEQAGEAEIY
RAYLEGTCVAWLRRYLERGNATLLRTDPPKAHVTHHPKSKRDVTLRCWALGFYPADITLT
WHLNGEELTQDMELVETRPAGDGTFQKWASVVVPLGMEQNYTCHVYHEGLPEALTLRWES
PPSTVSNMGIVVGLVVFGAVAIIVAVVAFVMMKKRRNTAFLLTGGKGGDYAPAPGREGSQ
TSDMSV
NT seq 1101 nt   +upstreamnt  +downstreamnt
atgggtgcgatggcaccacgcacgctgctcctgctgctggcggccgccctggccccgact
cagacccgcgcgggcccacactcgatgaggtatttccacaccgccgtgtcccggcccggc
ctcggggagccccggttcatcgctgtcggctacgtggacgacacgcagttcgtgcgcttc
gacagcgacgcggagaatccgagagctgagccgcgggcgccgtggatggagcaggagggg
ccggagtattgggaggagcagacacagatcgctaagggcaatgagcagagattccgagtg
agcctgaggaacctgctcggctactacaaccagagcgcgggcggctctcacacgttccag
tggatggtcggctgtgacgtggggtcggacgggcgcctcctccgcgggtactggcagtcc
gcatacgacggccgcgattacatcgccatgaacgaagacctgaaaacgtggacggcggcg
gacacggcggcgcagatcacccgacgcaagttggagcaggctggtgaagcagagatatac
agggcctacctggagggcacgtgcgtggcgtggctccgcagatacctggagcgcgggaat
gcgacgctgctgcgcacagatcccccaaaggcccatgtgacccatcaccccaaatctaaa
cgtgatgtcaccctgaggtgctgggccctgggcttctaccctgctgacatcaccctgacc
tggcatttgaatggggaggaactgacccaggacatggagcttgtggagaccaggcctgca
ggggatggaaccttccagaagtgggcatctgtggtggtgcctcttgggatggagcagaat
tacacatgccatgtgtaccatgaggggctgcctgaggccctcaccctgagatgggagtct
cctccatccactgtctccaacatgggaatcgttgttggtctggttgtctttggagctgtg
gccatcattgttgctgtggtggcttttgtgatgatgaagaagaggagaaacacagctttt
cttctcacaggtggaaaaggaggggactatgctccagctccaggcagagaaggctcccag
acctctgatatgtctgtctaa

KEGG   Mus caroli (Ryukyu mouse): 110312199
Entry
110312199         CDS       T05910                                 

Definition
(RefSeq) H-2 class I histocompatibility antigen, D-B alpha chain-like isoform X1
  KO
K06751  MHC class I antigen
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04144  Endocytosis
mcal04145  Phagosome
mcal04218  Cellular senescence
mcal04514  Cell adhesion molecules
mcal04612  Antigen processing and presentation
mcal04940  Type I diabetes mellitus
mcal05163  Human cytomegalovirus infection
mcal05165  Human papillomavirus infection
mcal05166  Human T-cell leukemia virus 1 infection
mcal05167  Kaposi sarcoma-associated herpesvirus infection
mcal05168  Herpes simplex virus 1 infection
mcal05169  Epstein-Barr virus infection
mcal05170  Human immunodeficiency virus 1 infection
mcal05203  Viral carcinogenesis
mcal05320  Autoimmune thyroid disease
mcal05330  Allograft rejection
mcal05332  Graft-versus-host disease
mcal05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    110312199
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    110312199
   04145 Phagosome
    110312199
  09143 Cell growth and death
   04218 Cellular senescence
    110312199
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    110312199
   04612 Antigen processing and presentation
    110312199
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    110312199
  09163 Immune disease
   05320 Autoimmune thyroid disease
    110312199
   05330 Allograft rejection
    110312199
   05332 Graft-versus-host disease
    110312199
  09166 Cardiovascular disease
   05416 Viral myocarditis
    110312199
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    110312199
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110312199
   05170 Human immunodeficiency virus 1 infection
    110312199
   05168 Herpes simplex virus 1 infection
    110312199
   05163 Human cytomegalovirus infection
    110312199
   05167 Kaposi sarcoma-associated herpesvirus infection
    110312199
   05169 Epstein-Barr virus infection
    110312199
   05165 Human papillomavirus infection
    110312199
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcal04147]
    110312199
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mcal00537]
    110312199
Exosome [BR:mcal04147]
 Exosomal proteins
  Proteins found in most exosomes
   110312199
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mcal00537]
 Antigens
  110312199
SSDB
Motif
Pfam: MHC_I C1-set MHC_I_C ig Ig_3 C2-set_2 Ig_2 Marek_A
Other DBs
NCBI-GeneID: 110312199
NCBI-ProteinID: XP_021041411
UniProt: A0A6P5R8D3
LinkDB
Position
17
AA seq 390 aa
MPCIPDGTMAPRTLFLLLAAALTLIETRAGSHSMRYFETAVSRPGLGEPRFISVGYVDDT
QFARFDSDAENPRYEPRALWMEQEGPEYWERNTRQAKGNEQSFRVSLRNLLGYYNQSAGG
SHTFQRLSGCDLGSDGSLLRGYEQFAYDGHDYIALNEDLKTWTAADMAAQITGRKWEQAG
VTEMYRAYLEGTCVEWLLRYLELGNATLLRTDPPKAHMTHHPRSEGDVTLRCWALGFYPA
DITLTWQLNGEELTQDMELVETRPAGDGTFQKWASVVVPRWKEQNYTCHVEHEGLPQPLT
LRWEPPPSMDSNMVIIAVLVVLGAVIIIGAMVAFMLKSRRTIGGKGGNYAPAGGNNSVQG
SALFLEAFKAILPGPARTKGHLHPDSSMLP
NT seq 1173 nt   +upstreamnt  +downstreamnt
atgccctgtatcccagatgggacaatggcgcctcgaacactgttcctgctgctggcggcc
gccctgaccctgatcgagacccgcgcaggctcacactcgatgcggtattttgagaccgcc
gtgtcccggcccggcctcggggagccccggttcatctctgtcggctacgtggacgacacg
cagttcgcgcgctttgacagcgacgcggagaatccgagatatgagccccgggcgctgtgg
atggagcaggaggggccggagtattgggagcggaacacacgccaggccaagggcaatgag
cagagtttccgagtgagcctgaggaacctgctcggctactacaaccagagcgcgggcggc
tctcacacattccagcggttgtcgggctgtgacttggggtcagacggaagcctcctccgc
gggtatgagcagttcgcttatgatggccacgattacatcgccctgaatgaagacctgaaa
acgtggacggcggcggacatggcggcacagatcacaggacgcaagtgggagcaggctggt
gttacagagatgtacagggcctacctggagggcacgtgcgtggagtggctcctcagatac
ctggagctcgggaatgcgacgctgctgcgcacagatcccccaaaggcccatatgacccat
caccccagatctgaaggtgatgtcaccctgaggtgctgggccctgggcttctaccctgct
gacatcaccctgacctggcagttgaatggggaggagctgacccaggacatggagcttgtg
gagaccaggcctgcaggggatggaaccttccagaagtgggcatctgtggtggtgcctcgt
tggaaggagcagaattatacatgccatgtggaacatgaggggctacctcagcccctcacc
ctgagatgggagcctcctccatccatggactccaacatggtaatcatagctgttctggtt
gtccttggagctgtgatcatcattggagctatggtggcttttatgttgaagagcaggaga
acaataggtggaaaaggagggaactatgctcctgctggaggcaacaacagtgtccagggc
tctgccttgtttctggaggccttcaaagccatccttcctggnccagcacgcactaaggga
catctgcatcctgacagctccatgctgccctga

KEGG   Mus caroli (Ryukyu mouse): 110312200
Entry
110312200         CDS       T05910                                 

Definition
(RefSeq) H-2 class I histocompatibility antigen, D-37 alpha chain
  KO
K06751  MHC class I antigen
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04144  Endocytosis
mcal04145  Phagosome
mcal04218  Cellular senescence
mcal04514  Cell adhesion molecules
mcal04612  Antigen processing and presentation
mcal04940  Type I diabetes mellitus
mcal05163  Human cytomegalovirus infection
mcal05165  Human papillomavirus infection
mcal05166  Human T-cell leukemia virus 1 infection
mcal05167  Kaposi sarcoma-associated herpesvirus infection
mcal05168  Herpes simplex virus 1 infection
mcal05169  Epstein-Barr virus infection
mcal05170  Human immunodeficiency virus 1 infection
mcal05203  Viral carcinogenesis
mcal05320  Autoimmune thyroid disease
mcal05330  Allograft rejection
mcal05332  Graft-versus-host disease
mcal05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    110312200
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    110312200
   04145 Phagosome
    110312200
  09143 Cell growth and death
   04218 Cellular senescence
    110312200
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    110312200
   04612 Antigen processing and presentation
    110312200
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    110312200
  09163 Immune disease
   05320 Autoimmune thyroid disease
    110312200
   05330 Allograft rejection
    110312200
   05332 Graft-versus-host disease
    110312200
  09166 Cardiovascular disease
   05416 Viral myocarditis
    110312200
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    110312200
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110312200
   05170 Human immunodeficiency virus 1 infection
    110312200
   05168 Herpes simplex virus 1 infection
    110312200
   05163 Human cytomegalovirus infection
    110312200
   05167 Kaposi sarcoma-associated herpesvirus infection
    110312200
   05169 Epstein-Barr virus infection
    110312200
   05165 Human papillomavirus infection
    110312200
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcal04147]
    110312200
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mcal00537]
    110312200
Exosome [BR:mcal04147]
 Exosomal proteins
  Proteins found in most exosomes
   110312200
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mcal00537]
 Antigens
  110312200
SSDB
Motif
Pfam: MHC_I C1-set C2-set_2 ig Ig_2
Other DBs
NCBI-GeneID: 110312200
NCBI-ProteinID: XP_021041413
Ensembl: MGP_CAROLIEiJ_G0021429
UniProt: A0A6P5REN9
LinkDB
Position
17
AA seq 363 aa
MLLFAHLLQLLTKATVLVSATVPTQTGPHSLRYFHTAVSRPGLGEPRFIIVGYVDDTQFV
RFDSDAENPRMEPRALWMKQEEPEYWERETRKARDMGRNFRVNLRTLLGYYNQSKDESHT
LQWMYGCDLGPDGRLLRGYCQEAYDGQDYISLNEDLRSWTATDFASQISKRKSEAAGEAH
QQRAYLQGPCVEWLQKYLQLGNETLLRSEPPKAHVTRHPRPEDEVTLRCWALDFYPADIT
LTWQLNGEELTQDMEFVETRPAGNGTFQKWASVVVPLGKEQNYTCHVYHEGLPEPLTLRW
EPPPSTDSNMVTHIAILVVLGAVAIIGAVVAFVMKRRHLGIKGSYAHVLGSKSFQTSDWP
QKA
NT seq 1092 nt   +upstreamnt  +downstreamnt
atgttgctttttgcccacttgctccagctgctgaccaaagccacagtgctggtcagcgcc
acagtcccgacccagactggcccacactcgctgcggtatttccacaccgccgtgtcccgg
cccggcctcggggagccccggttcatcattgtcggctacgtggacgacacgcagtttgtg
cgcttcgacagcgacgcggagaatccgaggatggagccgcgggcgctgtggatgaagcag
gaggagccggagtactgggagcgggagactcggaaagccagggacatggggaggaacttc
agagtaaacctgaggaccctgctcggctactacaatcagagtaaggacgaatctcacacg
ctgcagtggatgtatggctgcgacttggggcccgatgggcgcctgctccgcgggtattgt
caggaggcctacgatggccaggattacatctccctgaacgaggacctgcgctcctggacc
gcgactgactttgcctcacagatttctaagcgcaagtcagaggcggccggtgaggcccac
caacagagggcatacctgcaaggtccttgcgtggagtggctccagaaatacctacagctg
ggaaacgagacactgctgcgctcagaacccccaaaggcacatgtgacccgtcaccccaga
cctgaagatgaagtcaccctgaggtgctgggccctggacttctaccctgctgacatcacc
ctgacctggcagttgaatggggaggagctgacccaggacatggagtttgtggagaccagg
cctgcagggaatggaaccttccagaagtgggcatctgtggtggtgcctcttgggaaggag
cagaattacacatgccatgtgtaccatgaggggctgcctgagcccctcaccctgagatgg
gagcctcctccatccactgactccaatatggtgactcacattgctattctggttgtcctt
ggagctgtggccatcattggagctgtagtggcttttgtgatgaagaggagacacttaggt
ataaaaggaagctatgctcatgttctaggcagcaagagcttccagacctctgactggcct
cagaaggcatga

KEGG   Mus caroli (Ryukyu mouse): 110312201
Entry
110312201         CDS       T05910                                 

Definition
(RefSeq) H-2 class I histocompatibility antigen, Q7 alpha chain-like
  KO
K06751  MHC class I antigen
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04144  Endocytosis
mcal04145  Phagosome
mcal04218  Cellular senescence
mcal04514  Cell adhesion molecules
mcal04612  Antigen processing and presentation
mcal04940  Type I diabetes mellitus
mcal05163  Human cytomegalovirus infection
mcal05165  Human papillomavirus infection
mcal05166  Human T-cell leukemia virus 1 infection
mcal05167  Kaposi sarcoma-associated herpesvirus infection
mcal05168  Herpes simplex virus 1 infection
mcal05169  Epstein-Barr virus infection
mcal05170  Human immunodeficiency virus 1 infection
mcal05203  Viral carcinogenesis
mcal05320  Autoimmune thyroid disease
mcal05330  Allograft rejection
mcal05332  Graft-versus-host disease
mcal05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    110312201
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    110312201
   04145 Phagosome
    110312201
  09143 Cell growth and death
   04218 Cellular senescence
    110312201
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    110312201
   04612 Antigen processing and presentation
    110312201
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    110312201
  09163 Immune disease
   05320 Autoimmune thyroid disease
    110312201
   05330 Allograft rejection
    110312201
   05332 Graft-versus-host disease
    110312201
  09166 Cardiovascular disease
   05416 Viral myocarditis
    110312201
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    110312201
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110312201
   05170 Human immunodeficiency virus 1 infection
    110312201
   05168 Herpes simplex virus 1 infection
    110312201
   05163 Human cytomegalovirus infection
    110312201
   05167 Kaposi sarcoma-associated herpesvirus infection
    110312201
   05169 Epstein-Barr virus infection
    110312201
   05165 Human papillomavirus infection
    110312201
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcal04147]
    110312201
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mcal00537]
    110312201
Exosome [BR:mcal04147]
 Exosomal proteins
  Proteins found in most exosomes
   110312201
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mcal00537]
 Antigens
  110312201
SSDB
Motif
Pfam: MHC_I C1-set MHC_I_C Ig_3 ig C2-set_2 Ig_2 Marek_A Psg1
Other DBs
NCBI-GeneID: 110312201
NCBI-ProteinID: XP_021041414
Ensembl: MGP_CAROLIEiJ_G0021434
LinkDB
Position
17
AA seq 365 aa
MGAMAPRMLLLLLAASLKLTETRAGPHSLRYFHTAVSRPGLGEPRFIIVGYVDDTQFVRF
DSDAENPRMEPRALWMEQEGPEYWERNTQIAKENEQNFGRSLRKALSYYNQSKGGSHTFQ
WLVGCDLGPDGSLLRGYEQSAYDGRDYVALNEDLITWTAADLAALKTRRKLEQVNLAKKR
RDYLEGECLKWLRRYLEFGNATLLRKDPPKAHVTHHPRSEGDVTLRCWALGFYPADITLT
WQLNGEELTQDMEFVETRPAGDGTFQKWAAVVVPLGKEQKYTCHVEHEGLPEPLTLRWEP
PPYTVSNMVIIAVLVVVGAVIIIGAVVAFVMMMRRNTGGKVRDNAQDPGRDSPQSSDISL
LDCKA
NT seq 1098 nt   +upstreamnt  +downstreamnt
atgggggcaatggcgccgcgaatgctgctcctgctgctggcggcctcgctgaaactgact
gagacccgcgcgggcccacactcgctgcggtatttccacaccgccgtgtcccggcccggc
ctcggggagccccgattcattatcgtcggctacgtggacgacacgcagtttgtgcgcttc
gacagcgacgcggagaatccgaggatggagccgcgggcgctgtggatggagcaggagggg
ccggagtattgggagcggaacacgcagatcgccaaggaaaatgagcagaatttcggacgg
agcctgaggaaagcgctgagctactacaaccagagcaagggcggctctcacaccttccag
tggttggttggttgtgacctggggccagacgggagcctactccgagggtatgagcagtct
gcttacgatggccgcgattacgtcgccctgaacgaggatctgataacgtggacagcggcg
gacctggcggccctaaagacccgacgcaagttggagcaggttaatcttgcaaagaagcgc
agggactaccttgagggcgagtgtttgaagtggctccgcagatacctggagttcgggaat
gcgacgctgctgcgcaaagatcccccaaaggcacatgtgacccatcaccccagatctgaa
ggtgatgtcaccctgaggtgctgggccctaggcttctaccctgctgacatcaccctgacc
tggcagttgaatggggaggagctgacccaggacatggagtttgtggagaccaggcctgca
ggggatggaaccttccagaagtgggcagctgtggtggtgcctcttgggaaggagcagaag
tacacatgccatgtggaacatgaggggctgcctgagcccctcaccctgagatgggagcct
cctccatacactgtctccaacatggttatcattgctgttctggttgttgttggagctgtg
atcatcattggagctgtggtggcttttgtgatgatgatgaggagaaacacaggtggaaaa
gtaagagacaacgctcaggatccaggcagggacagcccccagagctctgatatctctctc
ctagattgtaaagcatga

KEGG   Mus caroli (Ryukyu mouse): 110312202
Entry
110312202         CDS       T05910                                 

Definition
(RefSeq) H-2 class I histocompatibility antigen, alpha chain-like isoform X1
  KO
K06751  MHC class I antigen
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04144  Endocytosis
mcal04145  Phagosome
mcal04218  Cellular senescence
mcal04514  Cell adhesion molecules
mcal04612  Antigen processing and presentation
mcal04940  Type I diabetes mellitus
mcal05163  Human cytomegalovirus infection
mcal05165  Human papillomavirus infection
mcal05166  Human T-cell leukemia virus 1 infection
mcal05167  Kaposi sarcoma-associated herpesvirus infection
mcal05168  Herpes simplex virus 1 infection
mcal05169  Epstein-Barr virus infection
mcal05170  Human immunodeficiency virus 1 infection
mcal05203  Viral carcinogenesis
mcal05320  Autoimmune thyroid disease
mcal05330  Allograft rejection
mcal05332  Graft-versus-host disease
mcal05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    110312202
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    110312202
   04145 Phagosome
    110312202
  09143 Cell growth and death
   04218 Cellular senescence
    110312202
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    110312202
   04612 Antigen processing and presentation
    110312202
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    110312202
  09163 Immune disease
   05320 Autoimmune thyroid disease
    110312202
   05330 Allograft rejection
    110312202
   05332 Graft-versus-host disease
    110312202
  09166 Cardiovascular disease
   05416 Viral myocarditis
    110312202
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    110312202
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110312202
   05170 Human immunodeficiency virus 1 infection
    110312202
   05168 Herpes simplex virus 1 infection
    110312202
   05163 Human cytomegalovirus infection
    110312202
   05167 Kaposi sarcoma-associated herpesvirus infection
    110312202
   05169 Epstein-Barr virus infection
    110312202
   05165 Human papillomavirus infection
    110312202
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcal04147]
    110312202
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mcal00537]
    110312202
Exosome [BR:mcal04147]
 Exosomal proteins
  Proteins found in most exosomes
   110312202
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mcal00537]
 Antigens
  110312202
SSDB
Motif
Pfam: MHC_I C1-set ig Ig_3 C2-set_2 Ig_2 Mucin
Other DBs
NCBI-GeneID: 110312202
NCBI-ProteinID: XP_021041415
Ensembl: MGP_CAROLIEiJ_G0021430
UniProt: A0A6P5R8Z8
LinkDB
Position
17
AA seq 321 aa
MQVLRFSSKEETPRMAPWLEQEEADDWKQQTRIVTIQGQLSERNLMTLVHFYNKSVDDSH
TLQWLQGCDVEPDRRLCLWYNQLAYDSEDLPTLNENPSSCTVGNSTVPHISQHLKSHCSD
LLQKYLEKGKERLLRSDPPKTHVTHHPRPEDEVTLRCWALGFYPADITLTWQKDGEELIQ
EMEFVETRPAGDGTFQKWATVVVPLGEEQNYTCHVHHEGLPEPLTLRWEPAWYQKPWIWI
VAMVFSILLICLCVACICMKKNAGGRGRPDTQEAGKDSPQDSSKLVQDDEEMGVPFWKIG
YYKTHLGHSPGTSVGLSLLSP
NT seq 966 nt   +upstreamnt  +downstreamnt
atgcaggtcctgcgcttcagcagcaaggaggagactccaaggatggcaccctggctggag
caggaggaagcagatgactggaagcagcagactcgtatagtcacaattcaaggacagctc
tctgaaaggaatctgatgaccctggttcatttttacaacaagagcgtggatgactctcac
acactacagtggctgcaaggctgcgatgtggagccagatcggcgcctgtgtctctggtac
aaccagctcgcctatgatagcgaggatctccccaccctgaacgaaaacccaagttcctgt
acagtgggaaacagcactgtacctcacatctctcagcacctgaagagccactgctcagat
ctgctgcagaaatacctggaaaaagggaaggagaggctgctgcgttcagaccccccaaag
acacatgtgacccatcatcccagacctgaagatgaagtcaccctgaggtgctgggccctg
ggcttctaccctgctgacatcaccctgacctggcagaaggatggggaggagctgatccaa
gaaatggagtttgtggagaccaggcctgcaggggatggaaccttccagaagtgggcaact
gtggtggtgcctcttggggaagagcagaattacacatgccatgtgcaccatgaggggctg
cctgagcccctcaccctgagatgggagcctgcatggtaccaaaagccttggatttggatt
gttgccatggttttttccattttgctcatttgtctctgtgtggcttgcatatgcatgaag
aagaatgcaggtgggagaggaaggcctgacacccaggaagcaggcaaagacagtccccaa
gactctagcaagcttgtccaggatgatgaggagatgggggttcccttttggaagattggg
tactataagactcatctaggccactcccctggaacttcagttggcttgtctttactgtca
ccttga

KEGG   Mus caroli (Ryukyu mouse): 110312220
Entry
110312220         CDS       T05910                                 

Definition
(RefSeq) H-2 class I histocompatibility antigen, Q10 alpha chain-like
  KO
K06751  MHC class I antigen
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04144  Endocytosis
mcal04145  Phagosome
mcal04218  Cellular senescence
mcal04514  Cell adhesion molecules
mcal04612  Antigen processing and presentation
mcal04940  Type I diabetes mellitus
mcal05163  Human cytomegalovirus infection
mcal05165  Human papillomavirus infection
mcal05166  Human T-cell leukemia virus 1 infection
mcal05167  Kaposi sarcoma-associated herpesvirus infection
mcal05168  Herpes simplex virus 1 infection
mcal05169  Epstein-Barr virus infection
mcal05170  Human immunodeficiency virus 1 infection
mcal05203  Viral carcinogenesis
mcal05320  Autoimmune thyroid disease
mcal05330  Allograft rejection
mcal05332  Graft-versus-host disease
mcal05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    110312220
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    110312220
   04145 Phagosome
    110312220
  09143 Cell growth and death
   04218 Cellular senescence
    110312220
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    110312220
   04612 Antigen processing and presentation
    110312220
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    110312220
  09163 Immune disease
   05320 Autoimmune thyroid disease
    110312220
   05330 Allograft rejection
    110312220
   05332 Graft-versus-host disease
    110312220
  09166 Cardiovascular disease
   05416 Viral myocarditis
    110312220
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    110312220
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110312220
   05170 Human immunodeficiency virus 1 infection
    110312220
   05168 Herpes simplex virus 1 infection
    110312220
   05163 Human cytomegalovirus infection
    110312220
   05167 Kaposi sarcoma-associated herpesvirus infection
    110312220
   05169 Epstein-Barr virus infection
    110312220
   05165 Human papillomavirus infection
    110312220
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcal04147]
    110312220
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mcal00537]
    110312220
Exosome [BR:mcal04147]
 Exosomal proteins
  Proteins found in most exosomes
   110312220
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mcal00537]
 Antigens
  110312220
SSDB
Motif
Pfam: MHC_I C1-set Ig_3 Ig_2
Other DBs
NCBI-GeneID: 110312220
NCBI-ProteinID: XP_021041430
UniProt: A0A6P5R910
LinkDB
Position
17
AA seq 215 aa
MALSFSYDHDYEPLGLYQACCAAEKLTLPYAYEGQDYIALNVDLKTWAMADMEALITPCK
WEQADKAEHYKTYLESTCVEWLQRYLELGKEMLLPPNTKVKHHPRPDGDVTLRCWTLGFY
PADITLTWQLNGEDLTQDMELVETRPAGDGDFQKWAALVVPSGEEQRYTCHVDNVRLPEV
LTLRWEPPQSIILIRTIVGAVLGAGKDVSGSKQAW
NT seq 648 nt   +upstreamnt  +downstreamnt
atggccttatccttctcttatgaccatgattatgagcccctaggactgtaccaggcctgt
tgtgcagctgagaaactgacattaccatatgcctatgaaggccaagattacatcgccctg
aacgttgacctgaaaacctgggcgatggcggacatggaggcgctcatcaccccatgcaag
tgggagcaggctgataaggcagaacattacaagacctacctggagagcacctgtgtggag
tggctccaaagatacctggagcttgggaaggagatgctgctacccccaaacacaaaagtg
aagcatcatcccagacctgatggtgatgtcaccctgaggtgctggaccctgggcttctac
cctgctgacatcaccctgacctggcagttgaatggagaggatctgacccaggacatggag
cttgtggagaccaggcctgcaggggatggagacttccagaagtgggcagctctggtggtg
ccttctggagaggagcagagatacacatgccatgtggacaatgtgaggctgcctgaggtc
ctcaccctgagatgggaacctcctcagtccatcatcctcattagaaccattgttggtgct
gtcctcggggctggaaaagatgtgtcagggagcaagcaggcctggtga

KEGG   Mus caroli (Ryukyu mouse): 110312221
Entry
110312221         CDS       T05910                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: H-2 class I histocompatibility antigen, Q10 alpha chain-like
  KO
K06751  MHC class I antigen
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04144  Endocytosis
mcal04145  Phagosome
mcal04218  Cellular senescence
mcal04514  Cell adhesion molecules
mcal04612  Antigen processing and presentation
mcal04940  Type I diabetes mellitus
mcal05163  Human cytomegalovirus infection
mcal05165  Human papillomavirus infection
mcal05166  Human T-cell leukemia virus 1 infection
mcal05167  Kaposi sarcoma-associated herpesvirus infection
mcal05168  Herpes simplex virus 1 infection
mcal05169  Epstein-Barr virus infection
mcal05170  Human immunodeficiency virus 1 infection
mcal05203  Viral carcinogenesis
mcal05320  Autoimmune thyroid disease
mcal05330  Allograft rejection
mcal05332  Graft-versus-host disease
mcal05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    110312221
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    110312221
   04145 Phagosome
    110312221
  09143 Cell growth and death
   04218 Cellular senescence
    110312221
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    110312221
   04612 Antigen processing and presentation
    110312221
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    110312221
  09163 Immune disease
   05320 Autoimmune thyroid disease
    110312221
   05330 Allograft rejection
    110312221
   05332 Graft-versus-host disease
    110312221
  09166 Cardiovascular disease
   05416 Viral myocarditis
    110312221
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    110312221
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110312221
   05170 Human immunodeficiency virus 1 infection
    110312221
   05168 Herpes simplex virus 1 infection
    110312221
   05163 Human cytomegalovirus infection
    110312221
   05167 Kaposi sarcoma-associated herpesvirus infection
    110312221
   05169 Epstein-Barr virus infection
    110312221
   05165 Human papillomavirus infection
    110312221
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcal04147]
    110312221
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mcal00537]
    110312221
Exosome [BR:mcal04147]
 Exosomal proteins
  Proteins found in most exosomes
   110312221
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mcal00537]
 Antigens
  110312221
SSDB
Motif
Pfam: MHC_I C1-set Ig_3 Ig_2
Other DBs
NCBI-GeneID: 110312221
NCBI-ProteinID: XP_021041431
UniProt: A0A6P5RBL5
LinkDB
Position
17
AA seq 325 aa
MEQGMLLLLQATALAWTQTREGSHSMRYFSTALSRPGQGKPLYMEAGYVDHKQFVRFDSD
AENPRYEPRAPWNELQGPEYWELQTKVAEGHEKSFQVNLRTLLGYYTQSKGGSQTFQWMY
GCDLGSDQNLLHGYXXYAHXGRDYIILKVDLKTWAAVDMEALITPRKWEQAEEAEHYKTY
QESTRVEWLQRYLEHGKEMLLHTDPPKTKVKDHPRPDGDVTLRCWALGFYPADITLTWQL
NGEDLTQDTELVETRSAGDGNFQKWAALVVPSGEEQRYTCHVDHERLPEALTLRWKPPQS
IILIRTIVGAVLGAGKDVSGSKQAW
NT seq 978 nt   +upstreamnt  +downstreamnt
atggagcagggaatgctgctcctgctgcaggcaaccgccctggcctggacccagacccgt
gagggctcacactcgatgcggtatttctccactgccttgtcccggcctggccagggcaaa
cccctgtacatggaagccggctacgtggatcacaagcagttcgtgcgctttgacagcgac
gcggagaatccgagatatgagccgcgtgcgccttggaatgagctccaggggcctgagtat
tgggagctacagacaaaagtcgcagagggccatgagaagagtttccaagtgaatctaagg
accctgcttggctactacacacagagcaagggtggctctcaaacgttccagtggatgtat
ggctgtgacttggggtcagaccagaaccttctccacgggtactagtagtatgcccactaa
ggccgcgattacatcatcctgaaggttgacctgaaaacctgggcggcggtagacatggag
gcgctcatcaccccacgcaagtgggagcaggctgaagaggcagagcattacaagacctac
caggagagcacccgcgtggagtggctccaaagatacctggagcacgggaaggagatgctg
ctgcacactgaccccccaaagacaaaagtgaaggatcatcccagacctgatggtgatgtc
accctaaggtgctgggccctgggcttctaccctgctgacatcaccctgacctggcagttg
aatggagaggatctgacccaggacacggagcttgtggagaccaggtctgcaggggatgga
aacttccagaagtgggcagctctggtggtgccttctggagaggagcagagatacacatgc
catgtggaccatgaaaggttgcctgaggccctcaccctgagatggaaacctcctcagtcc
atcatcctcattagaaccattgttggtgctgtcctcggggctggaaaagatgtgtcaggg
agcaagcaggcctggtga

KEGG   Mus caroli (Ryukyu mouse): 110312222
Entry
110312222         CDS       T05910                                 

Definition
(RefSeq) H-2 class I histocompatibility antigen, TLA(B) alpha chain-like
  KO
K06751  MHC class I antigen
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04144  Endocytosis
mcal04145  Phagosome
mcal04218  Cellular senescence
mcal04514  Cell adhesion molecules
mcal04612  Antigen processing and presentation
mcal04940  Type I diabetes mellitus
mcal05163  Human cytomegalovirus infection
mcal05165  Human papillomavirus infection
mcal05166  Human T-cell leukemia virus 1 infection
mcal05167  Kaposi sarcoma-associated herpesvirus infection
mcal05168  Herpes simplex virus 1 infection
mcal05169  Epstein-Barr virus infection
mcal05170  Human immunodeficiency virus 1 infection
mcal05203  Viral carcinogenesis
mcal05320  Autoimmune thyroid disease
mcal05330  Allograft rejection
mcal05332  Graft-versus-host disease
mcal05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    110312222
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    110312222
   04145 Phagosome
    110312222
  09143 Cell growth and death
   04218 Cellular senescence
    110312222
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    110312222
   04612 Antigen processing and presentation
    110312222
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    110312222
  09163 Immune disease
   05320 Autoimmune thyroid disease
    110312222
   05330 Allograft rejection
    110312222
   05332 Graft-versus-host disease
    110312222
  09166 Cardiovascular disease
   05416 Viral myocarditis
    110312222
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    110312222
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110312222
   05170 Human immunodeficiency virus 1 infection
    110312222
   05168 Herpes simplex virus 1 infection
    110312222
   05163 Human cytomegalovirus infection
    110312222
   05167 Kaposi sarcoma-associated herpesvirus infection
    110312222
   05169 Epstein-Barr virus infection
    110312222
   05165 Human papillomavirus infection
    110312222
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcal04147]
    110312222
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mcal00537]
    110312222
Exosome [BR:mcal04147]
 Exosomal proteins
  Proteins found in most exosomes
   110312222
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mcal00537]
 Antigens
  110312222
SSDB
Motif
Pfam: MHC_I C1-set Ig_3 C2-set_2 MHC_I_3 Ig_2 Crystall
Other DBs
NCBI-GeneID: 110312222
NCBI-ProteinID: XP_021041432
UniProt: A0A6P5R8F1
LinkDB
Position
17
AA seq 406 aa
MGSMVPGTLLILLAASPGQTQTCAGSHSLRYFYTALSRPAISEPWYIAVGYLDDIQFVRF
ESAGETATYKLRVPWVEQEGPEYWARETEIVTSNAQFFRENLQTMLDYYNLSQNGSHTIQ
VMYGCEVEYFGSVFRAYEQHGYDGRDYIALNGDLKTWTVADMAAEITRSKWEQAGYTELR
RTYLQGPCKDSLLRYLKNRKNTQVCTDPPKTHVTHHPRPEGDVTLRCWALGFYPADITLT
WQLNGEELIQDTELVETRPAGDGTYQKWAAVVVPSGAEQKYTCHVYHKGLLEPLTLRWEP
PQSSMPTRTIVCAVLGAMVILGFMSGSVMMWMIKNKGRNRDENTAACQNEGEQLPLSTRG
ESESLMVESGLKDLPPDSPVVSGQCLVTSSTTGKDSFCLVSGDLKR
NT seq 1221 nt   +upstreamnt  +downstreamnt
atggggagcatggtgcctggcaccctcctgatcctcctggctgcctcaccaggccagacc
cagacctgcgcaggctcacactcgctgaggtacttctacaccgccttgtcccgacctgca
atcagcgaaccatggtacatcgctgtgggctacctggatgacattcagttcgtgcgcttc
gaaagcgcaggggagactgcgacatataagctccgtgtgccatgggtggagcaagagggg
cccgagtattgggcgagagagacagagatcgtcacaagcaatgcacagtttttccgcgag
aatctgcagactatgctggactactacaacctgagccaaaatggctctcacaccatccag
gtgatgtatggctgtgaggtggagtatttcgggagcgtcttccgcgcttatgagcaacat
ggctatgatggccgcgattacattgccctgaatggagatctgaaaacgtggacagtggcg
gacatggcagcagagatcacccgaagcaagtgggagcaggctggttatacagagctccgt
aggacctacttgcagggtccatgcaaggattcactgctcagatacctgaagaacagaaaa
aatacacaggtgtgcacagatcctccaaaaacacatgtgacccatcaccccaggcctgaa
ggtgatgtcaccctgagatgctgggccctgggcttctaccctgctgacatcaccctgacc
tggcagttgaatggggaggaactgattcaggacacggagcttgtggagaccaggcctgca
ggggatgggacctaccagaagtgggcagctgtggtggtgccttctggggcagagcagaaa
tacacatgtcatgtgtaccataaggggctgcttgagcctctcaccctgagatgggagcct
cctcagtccagtatgcccaccaggaccattgtttgtgctgtccttggagctatggtcatc
ttaggttttatgagcggaagtgttatgatgtggatgataaagaacaaaggtagaaacaga
gacgaaaacactgctgcatgtcagaatgagggggaacagctgcccctgagcactcgaggt
gaatctgagtcactcatggtcgaatctgggctgaaggatcttcctccagactcaccagtg
gtctccggacagtgtcttgttacttcttctactacaggcaaggacagtttctgtcttgtc
tctggagacttgaaaaggtga

KEGG   Mus caroli (Ryukyu mouse): 110312399
Entry
110312399         CDS       T05910                                 

Definition
(RefSeq) H-2 class I histocompatibility antigen, Q9 alpha chain-like
  KO
K06751  MHC class I antigen
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04144  Endocytosis
mcal04145  Phagosome
mcal04218  Cellular senescence
mcal04514  Cell adhesion molecules
mcal04612  Antigen processing and presentation
mcal04940  Type I diabetes mellitus
mcal05163  Human cytomegalovirus infection
mcal05165  Human papillomavirus infection
mcal05166  Human T-cell leukemia virus 1 infection
mcal05167  Kaposi sarcoma-associated herpesvirus infection
mcal05168  Herpes simplex virus 1 infection
mcal05169  Epstein-Barr virus infection
mcal05170  Human immunodeficiency virus 1 infection
mcal05203  Viral carcinogenesis
mcal05320  Autoimmune thyroid disease
mcal05330  Allograft rejection
mcal05332  Graft-versus-host disease
mcal05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    110312399
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    110312399
   04145 Phagosome
    110312399
  09143 Cell growth and death
   04218 Cellular senescence
    110312399
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    110312399
   04612 Antigen processing and presentation
    110312399
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    110312399
  09163 Immune disease
   05320 Autoimmune thyroid disease
    110312399
   05330 Allograft rejection
    110312399
   05332 Graft-versus-host disease
    110312399
  09166 Cardiovascular disease
   05416 Viral myocarditis
    110312399
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    110312399
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110312399
   05170 Human immunodeficiency virus 1 infection
    110312399
   05168 Herpes simplex virus 1 infection
    110312399
   05163 Human cytomegalovirus infection
    110312399
   05167 Kaposi sarcoma-associated herpesvirus infection
    110312399
   05169 Epstein-Barr virus infection
    110312399
   05165 Human papillomavirus infection
    110312399
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcal04147]
    110312399
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mcal00537]
    110312399
Exosome [BR:mcal04147]
 Exosomal proteins
  Proteins found in most exosomes
   110312399
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mcal00537]
 Antigens
  110312399
SSDB
Motif
Pfam: MHC_I
Other DBs
NCBI-GeneID: 110312399
NCBI-ProteinID: XP_021041618
UniProt: A0A6P5RBZ0
LinkDB
Position
17
AA seq 233 aa
MGAMAPRTLLLLLAAALAPTQTRAGSHSMRYFETAVSRPGLGEPRFISVGYVDDTEFVRF
DSDAENPRDEPRAPWMEQEGPEYWERETQKSKGNEQSFRVSLRTALSYYNQSAGGSHTLQ
WMHGCEVGSDGRLLRGYLQSAYDGRDYIALNEDLKTWTAADMAAQITRRKWEQAGEAERY
RAYLEGACIEWLRRHLERGNATLQRKGAGAAGSSSLCPRAGAQSWGRRNPQLG
NT seq 702 nt   +upstreamnt  +downstreamnt
atgggggcgatggctccgcgcacgctgctcctgctgctggcggccgccctggccccgacc
cagacccgcgcgggctcacactcgatgcggtatttcgagaccgccgtgtcccggcccggc
ctcggggagccccggttcatctctgtgggctacgtggacgacacagagttcgtgcgcttc
gacagcgacgcggagaatccgagagatgagccgcgggcgccgtggatggagcaggagggg
ccggagtattgggagcgggagacacagaaatccaagggcaatgagcagagtttccgagtg
agcctgaggaccgcgctgagctactacaaccagagcgcgggcggctctcacacactccag
tggatgcatggctgtgaggtggggtcggacgggcgcctcctccgcgggtacctgcagtcc
gcatacgacggccgcgattacatcgccctgaacgaagacctgaaaacgtggacggcggcg
gacatggcggcgcagatcacccgacgcaagtgggagcaggctggtgaagcagagagatac
agggcctacctggagggcgcgtgcatagagtggctccgcagacacctggagcgcgggaat
gcgacgctgcagcgcaaaggtgctggggccgcgggcagctcctccctctgccctcgggct
ggggctcagtcctggggaagaagaaaccctcagctggggtga

KEGG   Mus caroli (Ryukyu mouse): 110312424
Entry
110312424         CDS       T05910                                 

Definition
(RefSeq) H-2 class I histocompatibility antigen, D-B alpha chain-like isoform X1
  KO
K06751  MHC class I antigen
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04144  Endocytosis
mcal04145  Phagosome
mcal04218  Cellular senescence
mcal04514  Cell adhesion molecules
mcal04612  Antigen processing and presentation
mcal04940  Type I diabetes mellitus
mcal05163  Human cytomegalovirus infection
mcal05165  Human papillomavirus infection
mcal05166  Human T-cell leukemia virus 1 infection
mcal05167  Kaposi sarcoma-associated herpesvirus infection
mcal05168  Herpes simplex virus 1 infection
mcal05169  Epstein-Barr virus infection
mcal05170  Human immunodeficiency virus 1 infection
mcal05203  Viral carcinogenesis
mcal05320  Autoimmune thyroid disease
mcal05330  Allograft rejection
mcal05332  Graft-versus-host disease
mcal05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    110312424
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    110312424
   04145 Phagosome
    110312424
  09143 Cell growth and death
   04218 Cellular senescence
    110312424
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    110312424
   04612 Antigen processing and presentation
    110312424
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    110312424
  09163 Immune disease
   05320 Autoimmune thyroid disease
    110312424
   05330 Allograft rejection
    110312424
   05332 Graft-versus-host disease
    110312424
  09166 Cardiovascular disease
   05416 Viral myocarditis
    110312424
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    110312424
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110312424
   05170 Human immunodeficiency virus 1 infection
    110312424
   05168 Herpes simplex virus 1 infection
    110312424
   05163 Human cytomegalovirus infection
    110312424
   05167 Kaposi sarcoma-associated herpesvirus infection
    110312424
   05169 Epstein-Barr virus infection
    110312424
   05165 Human papillomavirus infection
    110312424
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcal04147]
    110312424
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mcal00537]
    110312424
Exosome [BR:mcal04147]
 Exosomal proteins
  Proteins found in most exosomes
   110312424
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mcal00537]
 Antigens
  110312424
SSDB
Motif
Pfam: MHC_I C1-set ig C2-set_2 Ig_3 Marek_A Ig_2
Other DBs
NCBI-GeneID: 110312424
NCBI-ProteinID: XP_021041657
UniProt: A0A6P5R8W6
LinkDB
Position
17
AA seq 346 aa
MFPSMLLLLLAAALALKETGAGSHSMRYYHTALSRPGLGEPRFISVGYVDDTQFLRFDSD
TKNPRYEPRVSWMEQEGPEYWERETQKAKGNEQRFRVSLRTALSYYNQSAGGSHTFQWLS
GCDVGSDGSLLRGYLQFAYDGRDYIALNEDLKTWTAADTAALKTRSKWEKDGAAEMYRAY
LEGECMERLRRYLERGNATLLRTDPPKAHVTHHPRSHGDVTLRCWALGFYPADITLTWQL
NGEELTQDMEXVETRPAGDGTFQKWAAVVVPVGKEQNYICHVEHEGLSAPLTLRWDPPPP
TDSHMVIIAVLVVLGAVIIIGAVVAFVLKRRRHTGGKVRDYAPDPS
NT seq 1041 nt   +upstreamnt  +downstreamnt
atgtttccgagcatgctgctcctgctgctggcggccgccctggccctgaaggagaccgga
gccggctcacactcgatgcggtattaccacactgccttgtcccggcccggcctcggggag
ccccggttcatctctgtcggctacgtggacgacacgcagttcctgcgcttcgacagcgac
acgaagaatccgagatacgagcctcgagtgtcgtggatggagcaggaggggccggagtat
tgggagcgggagacacagaaagccaagggcaatgagcagagattccgagtgagcctgagg
accgcgctgagctactacaaccagagcgcgggcggctctcacaccttccagtggttgtct
ggctgtgacgtggggtcggacgggagcctcctccgcgggtatctgcagttcgcctacgac
ggccgcgattacatcgccctgaatgaagatctgaaaacgtggacagcagcggacacggcg
gcgctgaaaacccgaagcaagtgggagaaggatggagctgcagagatgtacagggcctac
ctggagggcgagtgcatggagaggctccgcagatacctggagcgcgggaatgcgacgctg
ctgcgcacagatcccccaaaggcacatgtgacccatcaccccagatctcatggtgatgtc
accctgaggtgctgggccctgggcttctaccctgctgacatcaccctgacctggcagttg
aatggggaggagctgacccaggacatggagnttgtggagaccaggcctgcaggggatgga
accttccagaagtgggcagctgtggtggtgcctgttgggaaggagcagaattacatatgc
catgtggaacatgaggggctgtctgcgcccctcaccctgagatgggatcctcctccaccc
acagactcccacatggtaatcattgctgttctggttgtccttggagctgtgattatcatt
ggagctgtggtggcttttgtgctgaagaggaggagacacacaggtggaaaagtaagagac
tacgctccggatccaagttag

KEGG   Mus caroli (Ryukyu mouse): 110312557
Entry
110312557         CDS       T05910                                 

Definition
(RefSeq) H-2 class I histocompatibility antigen, Q10 alpha chain-like isoform X1
  KO
K06751  MHC class I antigen
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04144  Endocytosis
mcal04145  Phagosome
mcal04218  Cellular senescence
mcal04514  Cell adhesion molecules
mcal04612  Antigen processing and presentation
mcal04940  Type I diabetes mellitus
mcal05163  Human cytomegalovirus infection
mcal05165  Human papillomavirus infection
mcal05166  Human T-cell leukemia virus 1 infection
mcal05167  Kaposi sarcoma-associated herpesvirus infection
mcal05168  Herpes simplex virus 1 infection
mcal05169  Epstein-Barr virus infection
mcal05170  Human immunodeficiency virus 1 infection
mcal05203  Viral carcinogenesis
mcal05320  Autoimmune thyroid disease
mcal05330  Allograft rejection
mcal05332  Graft-versus-host disease
mcal05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    110312557
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    110312557
   04145 Phagosome
    110312557
  09143 Cell growth and death
   04218 Cellular senescence
    110312557
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    110312557
   04612 Antigen processing and presentation
    110312557
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    110312557
  09163 Immune disease
   05320 Autoimmune thyroid disease
    110312557
   05330 Allograft rejection
    110312557
   05332 Graft-versus-host disease
    110312557
  09166 Cardiovascular disease
   05416 Viral myocarditis
    110312557
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    110312557
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110312557
   05170 Human immunodeficiency virus 1 infection
    110312557
   05168 Herpes simplex virus 1 infection
    110312557
   05163 Human cytomegalovirus infection
    110312557
   05167 Kaposi sarcoma-associated herpesvirus infection
    110312557
   05169 Epstein-Barr virus infection
    110312557
   05165 Human papillomavirus infection
    110312557
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcal04147]
    110312557
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mcal00537]
    110312557
Exosome [BR:mcal04147]
 Exosomal proteins
  Proteins found in most exosomes
   110312557
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mcal00537]
 Antigens
  110312557
SSDB
Motif
Pfam: MHC_I C1-set ig Ig_3 C2-set_2
Other DBs
NCBI-GeneID: 110312557
NCBI-ProteinID: XP_021041908
Ensembl: MGP_CAROLIEiJ_G0021577
UniProt: A0A6P5RCM3
LinkDB
Position
17
AA seq 350 aa
MGSSSNRALLHLVVVSFTVTQTGSGSHSLRYFHTAVSRPGRGEPQYISVGYVDDMQFQRC
DSIEEIPRMEPRAPWMEKERPEYWKELKLKVKNIAQSSRANLRTLLRYYNQSEGGSHILQ
WMVSCEVGPDMRLLGAHYQAAYDGSDYITLNEDLSSWTAVDMVSQITKSRFESAGTAEYF
RAYVEGECLELLHRFLRNGKEILQRADPPKAHVAHHPRPEGDATLRCWALGFYPADITLT
WQKDEEDLTQDMELVETRPSGDGTFQKWAAVVVPSGEEQRYTCYVHHEGLTEPLALKWDL
LNHLLSSWSSLLVWFSWEVCSLLLWCARGGVQGKDESVILRLPAGTVIKF
NT seq 1053 nt   +upstreamnt  +downstreamnt
atggggtcctcaagcaaccgcgctctcctgcacttggtggtggtctcttttactgttacc
caaacaggttctggctcacattcgctgcgctatttccacactgcggtgtcacggccgggc
cgtggggagccccagtatatctctgtgggctacgtggacgacatgcagtttcagcgctgt
gatagcattgaggaaattccgaggatggagcctcgtgcaccttggatggagaaggaaaga
ccagagtactggaaggagctgaaactcaaggtcaagaacattgcgcaaagttccagagca
aaccttcggaccctgctccgctactacaaccagagtgaaggcggctctcacatcctgcag
tggatggtttcctgtgaggtagggccagacatgcgcctacttggagcccactatcaggct
gcgtatgatggctcagattacatcaccctgaatgaagacctgagctcctggactgcagtg
gacatggtgtctcagatcacgaagagccgtttcgagtcagctggcacagcagagtacttc
agggcctatgtggagggagagtgcctggagctgctccacagattcctgcggaatggcaag
gagattcttcagcgagcagatcccccaaaggcacatgtggcccatcaccctagacccgaa
ggtgatgctaccttgaggtgctgggccctgggcttctaccctgctgacatcaccctgacc
tggcaaaaggatgaagaggacctgacccaggacatggagcttgtggagacaaggccttca
ggggatgggaccttccagaagtgggcagctgtggtggtgccttctggagaggagcagaga
tacacatgctatgtgcaccatgaggggctaactgagccccttgccctgaaatgggatctt
ctcaatcatctgttgtcatcatggtcatcgttgctagtctggttctcctgggaggtgtgc
tcactattgttgtggtgtgcaagaggaggggtgcaggggaaagatgaatcagttatactc
agactgccagcaggaacagtgattaagttctga

DBGET integrated database retrieval system