KEGG   Mus caroli (Ryukyu mouse): 110283647
Entry
110283647         CDS       T05910                                 

Gene name
Hsp90ab1
Definition
(RefSeq) heat shock protein HSP 90-beta
  KO
K04079  molecular chaperone HtpG
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04141  Protein processing in endoplasmic reticulum
mcal04151  PI3K-Akt signaling pathway
mcal04217  Necroptosis
mcal04612  Antigen processing and presentation
mcal04621  NOD-like receptor signaling pathway
mcal04657  IL-17 signaling pathway
mcal04659  Th17 cell differentiation
mcal04914  Progesterone-mediated oocyte maturation
mcal04915  Estrogen signaling pathway
mcal05132  Salmonella infection
mcal05200  Pathways in cancer
mcal05215  Prostate cancer
mcal05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    110283647 (Hsp90ab1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    110283647 (Hsp90ab1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    110283647 (Hsp90ab1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    110283647 (Hsp90ab1)
   04612 Antigen processing and presentation
    110283647 (Hsp90ab1)
   04659 Th17 cell differentiation
    110283647 (Hsp90ab1)
   04657 IL-17 signaling pathway
    110283647 (Hsp90ab1)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    110283647 (Hsp90ab1)
   04914 Progesterone-mediated oocyte maturation
    110283647 (Hsp90ab1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110283647 (Hsp90ab1)
  09162 Cancer: specific types
   05215 Prostate cancer
    110283647 (Hsp90ab1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    110283647 (Hsp90ab1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110283647 (Hsp90ab1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mcal01009]
    110283647 (Hsp90ab1)
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:mcal03110]
    110283647 (Hsp90ab1)
   04131 Membrane trafficking [BR:mcal04131]
    110283647 (Hsp90ab1)
   03051 Proteasome [BR:mcal03051]
    110283647 (Hsp90ab1)
   03029 Mitochondrial biogenesis [BR:mcal03029]
    110283647 (Hsp90ab1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcal04147]
    110283647 (Hsp90ab1)
Protein phosphatases and associated proteins [BR:mcal01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     110283647 (Hsp90ab1)
Chaperones and folding catalysts [BR:mcal03110]
 Heat shock proteins
  HSP90
   110283647 (Hsp90ab1)
Membrane trafficking [BR:mcal04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    110283647 (Hsp90ab1)
Proteasome [BR:mcal03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    110283647 (Hsp90ab1)
Mitochondrial biogenesis [BR:mcal03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Parkin-independent mechanism factors
    110283647 (Hsp90ab1)
Exosome [BR:mcal04147]
 Exosomal proteins
  Proteins found in most exosomes
   110283647 (Hsp90ab1)
SSDB
Motif
Pfam: HSP90 HATPase_c HATPase_c_3
Other DBs
NCBI-GeneID: 110283647
NCBI-ProteinID: XP_021004713
Ensembl: MGP_CAROLIEiJ_G0021648
UniProt: A0A6P5NYC0
LinkDB
Position
17
AA seq 724 aa
MPEEVHHGEEEVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNASDALDKIRYESLT
DPSKLDSGKELKIDIIPNPQERTLTLVDTGIGMTKADLINNLGTIAKSGTKAFMEALQAG
ADISMIGQFGVGFYSAYLVAEKVVVITKHNDDEQYAWESSAGGSFTVRADHGEPIGRGTK
VILHLKEDQTEYLEERRVKEVVKKHSQFIGYPITLYLEKEREKEISDDEAEEEKGEKEEE
DKEDEEKPKIEDVGSDEEDDSGKDKKKKTKKIKEKYIDQEELNKTKPIWTRNPDDITQEE
YGEFYKSLTNDWEDHLAVKHFSVEGQLEFRALLFIPRRAPFDLFENKKKKNNIKLYVRRV
FIMDSCDELIPEYLNFIRGVVDSEDLPLNISREMLQQSKILKVIRKNIVKKCLELFSELA
EDKENYKKFYEAFSKNLKLGIHEDSTNRRRLSELLRYHTSQSGDEMTSLSEYVSRMKETQ
KSIYYITGESKEQVANSAFVERVRKRGFEVVYMTEPIDEYCVQQLKEFDGKSLVSVTKEG
LELPEDEEEKKKMEESKAKFENLCKLMKEILDKKVEKVTISNRLVSSPCCIVTSTYGWTA
NMERIMKAQALRDNSTMGYMMAKKHLEINPDHPIVETLRQKAEADKNDKAVKDLVVLLFE
TALLSSGFSLEDPQTHSNRIYRMIKLGLGIDEDEVTAEEPSAAVPDEIPPLEGDEDASRM
EEVD
NT seq 2175 nt   +upstreamnt  +downstreamnt
atgcctgaggaagtgcaccatggagaggaggaggtggagacctttgcctttcaggcagaa
attgcccagctcatgtccctcatcatcaacactttctattcaaacaaggagattttcctc
cgcgagttgatctctaatgcttcagatgccctggacaagattcggtatgagagcctgacg
gacccttctaagttggacagcgggaaagagctgaaaattgacatcatccccaaccctcag
gagcgcacgctgactttggtggacacaggcattggcatgaccaaggctgacctcattaat
aacctgggaaccattgctaagtctggcacgaaggcgttcatggaggctctccaggctggt
gcagacatctccatgatcgggcagtttggtgtcggattctactcggcctatctagtggca
gagaaagtggttgtgatcacaaagcacaatgatgatgagcagtatgcctgggagtcgtct
gcgggtggctccttcaccgtccgggcagaccatggtgagcccattggccggggtaccaaa
gtgatccttcacctcaaagaagaccagacagagtacctggaggagaggagggtcaaggaa
gtggtgaagaaacactcgcagttcataggctatcccatcaccctctatttggagaaggaa
cgggagaaggagatcagtgatgacgaggcagaggaagagaaaggtgagaaagaggaggaa
gataaggaggatgaggagaagcctaagattgaagatgtggggtctgatgaggaagatgac
agcggcaaagacaagaaaaagaaaacaaagaagatcaaagagaagtacattgaccaggag
gagctgaacaagacaaagcctatctggaccagaaacccggatgacatcacacaggaggag
tatggggaattctataagagcctcaccaatgattgggaggaccacttggcagtcaagcac
ttctcggtagaaggtcagttggaattcagggcattgctcttcattccccggcgagctccc
tttgacctttttgagaacaagaagaagaagaacaacatcaaattgtatgtccgccgtgtg
ttcatcatggacagctgtgatgagctgatacccgagtacctcaactttatccgcggtgtg
gttgactctgaggacctgcccctgaacatctcccgggagatgctgcagcagagcaagatc
ctgaaggtcatccgtaagaacatcgtcaagaagtgcctggagctcttctccgagctggcc
gaggacaaggagaactacaagaagttctacgaggccttctccaagaatttaaagcttgga
attcatgaagattccactaaccgtcgccgcctctctgagctccttcgctatcacacctct
cagtctggagatgagatgacttccttgtcagagtatgtgtctcgcatgaaggagacccag
aagtccatctactatatcactggtgagagcaaagagcaagtggccaactctgcctttgtg
gagcgagtgcggaagcggggcttcgaggtggtgtatatgactgagcctattgacgagtac
tgcgtgcagcagctcaaggagtttgatgggaagagcctggtctcagtgactaaggagggc
ctggagctaccagaggacgaggaagagaagaaaaaaatggaagagagcaaggcaaagttt
gagaatctctgcaagctcatgaaggagatcttggacaagaaggttgaaaaggtgacaatc
tccaataggcttgtgtcttccccctgctgcattgtgacaagcacctacggctggacagcc
aacatggagcggatcatgaaggcccaggcactgcgagacaactctacgatgggctacatg
atggccaaaaaacacctggagatcaaccctgaccaccccatcgtggagaccctgcggcag
aaggctgaggcagacaaaaacgacaaagctgtcaaggacctggtggtgctgctgtttgaa
actgctctgctctcctctggtttctcacttgaggatccccaaacccactccaaccgcatc
taccgcatgattaaactaggcctgggcatcgatgaagatgaggtcactgcagaggagccc
agtgctgctgttcctgatgagatccccccgctggaaggcgatgaggatgcctctcgcatg
gaagaagtggattaa

KEGG   Mus caroli (Ryukyu mouse): 110302810
Entry
110302810         CDS       T05910                                 

Gene name
Hsp90b1
Definition
(RefSeq) endoplasmin
  KO
K09487  heat shock protein 90kDa beta
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04141  Protein processing in endoplasmic reticulum
mcal04151  PI3K-Akt signaling pathway
mcal04657  IL-17 signaling pathway
mcal04915  Estrogen signaling pathway
mcal04918  Thyroid hormone synthesis
mcal05132  Salmonella infection
mcal05200  Pathways in cancer
mcal05215  Prostate cancer
mcal05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    110302810 (Hsp90b1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    110302810 (Hsp90b1)
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    110302810 (Hsp90b1)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    110302810 (Hsp90b1)
   04918 Thyroid hormone synthesis
    110302810 (Hsp90b1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110302810 (Hsp90b1)
  09162 Cancer: specific types
   05215 Prostate cancer
    110302810 (Hsp90b1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    110302810 (Hsp90b1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110302810 (Hsp90b1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:mcal03110]
    110302810 (Hsp90b1)
Chaperones and folding catalysts [BR:mcal03110]
 Heat shock proteins
  HSP90
   110302810 (Hsp90b1)
SSDB
Motif
Pfam: HSP90 HATPase_c HATPase_c_3 DUF4518
Other DBs
NCBI-GeneID: 110302810
NCBI-ProteinID: XP_021029206
Ensembl: MGP_CAROLIEiJ_G0015694
UniProt: A0A6P5Q918
LinkDB
Position
10
AA seq 803 aa
MRVLWVLGLCCVLLTFGFVRADDEVDVDGTVEEDLGKSREGSRTDDEVVQREEEAIQLDG
LNASQIRELREKSEKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISL
TDENALAGNEELTVKIKCDKEKNLLHVTDTGVGMTREELVKNLGTIAKSGTSEFLNKMTE
AQEDGQSTSELIGQFGVGFYSAFLVADKVIVTSKHNNDTQHIWESDSNEFSVIADPRGDT
LGRGTTITLVLKEEASDYLELDTIKNLVRKYSQFINFPIYVWSSKTETVEEPLEEDEAAK
EEKEESDDEAAVEEEEEEKKPKTKKVEKTVWDWELMNDIKPIWQRPSKEVEEDEYKAFYK
SFSKESDDPMAYIHFTAEGEVTFKSILFVPTSAPRGLFDEYGSKKSDYIKLYVRRVFITD
DFHDMMPKYLNFVKGVVDSDDLPLNVSRETLQQHKLLKVIRKKLVRKTLDMIKKIADEKY
NDTFWKEFGTNIKLGVIEDHSNRTRLAKLLRFQSSHHSTDITSLDQYVERMKEKQDKIYF
MAGSSRKEAESSPFVERLLKKGYEVIYLTEPVDEYCIQALPEFDGKRFQNVAKEGVKFDE
SEKTKESREATEKEFEPLLNWMKDKALKDKIEKAVVSQRLTESPCALVASQYGWSGNMER
IMKAQAYQTGKDISTNYYASQKKTFEINPRHPLIRDMLRRIKEDEDDKTVMDLAVVLFET
ATLRSGYLLPDTKAYGDRIERMLRLSLNIDPEAQVEEEPEEEPEDTSEDTEDSEQDEEEE
MDAGTEEEEEQETEKESTEKDEL
NT seq 2412 nt   +upstreamnt  +downstreamnt
atgagggtcctgtgggtgttgggcctctgctgcgtcctgctgaccttcgggttcgtcaga
gctgatgatgaagtcgacgtggatggcacagtggaagaggacctgggtaaaagccgagaa
ggctcaaggacagatgatgaagttgtgcagagagaggaagaagctattcagctggatggg
ttaaacgcatcacagataagagaacttagagaaaaatctgaaaagttcgccttccaagct
gaagtgaacaggatgatgaaacttatcatcaattctttgtataaaaataaagagattttc
ctgagagaactgatttcaaatgcttctgatgctttagacaagataaggctcatctcacta
actgatgaaaatgcactcgctggaaatgaggagttaacggtcaagattaagtgtgacaaa
gagaaaaacctgctgcatgtcacagacacgggtgtaggaatgactagagaggagttggtt
aaaaacctcggcaccatagccaaatctggaacaagcgagtttttaaacaaaatgacagaa
gctcaagaagatggtcagtcaacctctgaactgattggccagtttggtgtcggtttttat
tctgccttccttgtagcagataaggtcattgtcacatcgaaacacaacaatgatacccag
cacatctgggaatcagactccaatgaattctctgtaattgctgacccaagaggagacaca
ctaggtcgcggaacaacaattactcttgttttaaaagaagaagcatctgattaccttgaa
ttggatacaattaaaaatctcgtcaggaagtactctcagttcatcaacttccccatctac
gtgtggagtagcaagactgagactgttgaggagcccttggaagaagatgaagcagcaaaa
gaagagaaagaagaatctgatgatgaagctgcagtagaggaggaggaagaagaaaagaaa
ccaaaaactaagaaagttgaaaaaactgtgtgggattgggaacttatgaatgatatcaaa
ccaatatggcagagaccatccaaagaagtagaagaagacgaatacaaagctttctacaaa
tcattttcaaaggaaagtgatgaccccatggcttatatccacttcactgcagaaggggag
gtcaccttcaagtcgattttgtttgtacccacatctgcaccccgaggtctgtttgatgaa
tatggatctaagaagagtgattatattaagctgtatgtacgccgcgtattcatcacagat
gacttccatgatatgatgcccaagtaccttaattttgtcaaaggtgttgtggattccgat
gatctccccctcaatgtttcccgtgagactcttcagcaacataaattgctcaaggtgatt
aggaagaagcttgtccgaaaaactctggacatgatcaagaagattgctgatgagaagtac
aacgatactttctggaaggagttcggcacgaatatcaagcttggagtgattgaagaccac
tcaaatcgaacacggcttgctaaacttcttaggttccagtcttctcaccattcaactgac
attactagtttagaccagtatgtggaaagaatgaaggaaaaacaggacaaaatctacttc
atggctgggtcaagcagaaaggaggcggaatcttctccatttgttgagagacttctgaag
aagggctatgaagtcatttatctcacagagcctgtggatgaatactgcattcaggctctt
cctgagtttgatgggaagaggtttcagaatgttgccaaagaaggagtgaagtttgatgag
agtgagaaaacgaaagaaagtcgggaagcaacagagaaggagtttgaacctctgctcaac
tggatgaaagataaggccctcaaggacaagatagaaaaggctgtggtgtcgcagcgcctc
acagagtctccctgtgctcttgtggccagtcagtatggatggtctggcaacatggagagg
atcatgaaggcccaagcataccagacgggcaaggacatctctacaaattactatgccagt
caaaagaaaacgtttgaaatcaatcctagacacccactgatcagagacatgttgcggcgg
attaaggaagatgaagatgacaagacagtcatggatcttgctgtagttttgtttgaaacg
gcaacacttcggtcaggatatcttctaccagacaccaaggcatatggagatagaatagaa
agaatgcttcgcctcagtttaaacattgaccctgaagcacaggtggaggaagaaccagaa
gaagagcctgaagacacctcagaagacacagaagactcagagcaggatgaggaagaagag
atggatgcagggacagaagaagaagaagaacaggaaacagaaaaggaatctacagagaag
gatgaattgtaa

KEGG   Mus caroli (Ryukyu mouse): 110307130
Entry
110307130         CDS       T05910                                 

Gene name
Hsp90aa1
Definition
(RefSeq) heat shock protein HSP 90-alpha
  KO
K04079  molecular chaperone HtpG
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04141  Protein processing in endoplasmic reticulum
mcal04151  PI3K-Akt signaling pathway
mcal04217  Necroptosis
mcal04612  Antigen processing and presentation
mcal04621  NOD-like receptor signaling pathway
mcal04657  IL-17 signaling pathway
mcal04659  Th17 cell differentiation
mcal04914  Progesterone-mediated oocyte maturation
mcal04915  Estrogen signaling pathway
mcal05132  Salmonella infection
mcal05200  Pathways in cancer
mcal05215  Prostate cancer
mcal05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    110307130 (Hsp90aa1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    110307130 (Hsp90aa1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    110307130 (Hsp90aa1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    110307130 (Hsp90aa1)
   04612 Antigen processing and presentation
    110307130 (Hsp90aa1)
   04659 Th17 cell differentiation
    110307130 (Hsp90aa1)
   04657 IL-17 signaling pathway
    110307130 (Hsp90aa1)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    110307130 (Hsp90aa1)
   04914 Progesterone-mediated oocyte maturation
    110307130 (Hsp90aa1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110307130 (Hsp90aa1)
  09162 Cancer: specific types
   05215 Prostate cancer
    110307130 (Hsp90aa1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    110307130 (Hsp90aa1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110307130 (Hsp90aa1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mcal01009]
    110307130 (Hsp90aa1)
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:mcal03110]
    110307130 (Hsp90aa1)
   04131 Membrane trafficking [BR:mcal04131]
    110307130 (Hsp90aa1)
   03051 Proteasome [BR:mcal03051]
    110307130 (Hsp90aa1)
   03029 Mitochondrial biogenesis [BR:mcal03029]
    110307130 (Hsp90aa1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcal04147]
    110307130 (Hsp90aa1)
Protein phosphatases and associated proteins [BR:mcal01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     110307130 (Hsp90aa1)
Chaperones and folding catalysts [BR:mcal03110]
 Heat shock proteins
  HSP90
   110307130 (Hsp90aa1)
Membrane trafficking [BR:mcal04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    110307130 (Hsp90aa1)
Proteasome [BR:mcal03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    110307130 (Hsp90aa1)
Mitochondrial biogenesis [BR:mcal03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Parkin-independent mechanism factors
    110307130 (Hsp90aa1)
Exosome [BR:mcal04147]
 Exosomal proteins
  Proteins found in most exosomes
   110307130 (Hsp90aa1)
SSDB
Motif
Pfam: HSP90 HATPase_c_3 LOH1CR12 Zip
Other DBs
NCBI-GeneID: 110307130
NCBI-ProteinID: XP_021035041
Ensembl: MGP_CAROLIEiJ_G0018117
UniProt: A0A6P5QUE8
LinkDB
Position
12
AA seq 661 aa
MPEETQTQDQPMEEEEVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDVSRPLG
RFGVGFYSAYLVAEKVTVITKHNDDEQYAWESSAGGSFTVRTDTGEPMGRGTKVILHLKE
DQTEYLEERRIKEIVKKHSQFIGYPITLFVEKERDKEVSDDEAEEKEEKEEEKEKEEKES
DDKPEIEDVGSDEEEEEKKDGDKKKKKKIKEKYIDQEELNKTKPIWTRNPDDITNEEYGE
FYKSLTNDWEEHLAVKHFSVEGQLEFRALLFVPRRAPFDLFENRKKKNNIKLYVRRVFIM
DNCEELIPEYLNFIRGVVDSEDLPLNISREMLQQSKILKVIRKNLVKKCLELFTELAEDK
ENYKKFYEQFSKNIKLGIHEDSQNRKKLSELLRYYTSASGDEMVSLKDYCTRMKENQKHI
YFITGETKDQVANSAFVERLRKHGLEVIYMIEPIDEYCVQQLKEFEGKTLVSVTKEGLEL
PEDEEEKKKQEEKKTKFENLCKIMKDILEKKVEKVVVSNRLVTSPCCIVTSTYGWTANME
RIMKAQALRDNSTMGYMAAKKHLEINPDHSIIETLRQKAEADKNDKSVKDLVILLYETAL
LSSGFSLEDPQTHANRIYRMIKLGLGIDEDDPTVDDTSAAVTEEMPPLEGDDDTSRMEEV
D
NT seq 1986 nt   +upstreamnt  +downstreamnt
atgcctgaggaaacccagacccaagaccaaccaatggaggaggaggaggtcgagaccttt
gcctttcaggcagaaattgcccagttaatgtccttgatcatcaataccttctactcgaac
aaagagatctttctgagggagctcatctccaattcatcggacgtgagtagaccacttgga
cgttttggtgttggtttttactctgcgtatttggttgctgagaaagtgactgtcatcacc
aagcataacgacgatgagcagtatgcctgggagtcctcagctgggggatccttcacagtg
aggactgacacaggtgaaccaatgggtcgtggaacaaaggttatcttgcatctgaaagaa
gaccaaactgagtatttggaggaaaggagaataaaggagatcgtgaagaagcattctcag
ttcattggctatcccattactctctttgtggagaaggaacgagataaggaagtcagtgat
gatgaggctgaagaaaaggaagagaaagaggaagagaaagaaaaagaagaaaaggagtct
gatgataaacctgaaatagaagatgttggttctgatgaagaggaggaggagaagaaggat
ggtgacaagaagaaaaagaagaagataaaggaaaagtacattgatcaagaagaactcaac
aaaaccaagccgatttggacgagaaatcctgatgacatcactaatgaggaatatggagag
ttctacaagagcttaaccaacgattgggaagaacatttggcagtaaagcatttttctgtt
gaaggacaattagaattccgggcccttctttttgtcccaagacgcgctccttttgatctg
tttgaaaacagaaagaagaagaacaacattaagttgtatgttcgcagagttttcatcatg
gataactgcgaggagctaatcccggagtatctgaatttcattagaggggtagtggattct
gaggatctccctctaaatatttcccgtgaaatgctgcaacaaagcaaaattctgaaagtt
atcagaaagaatttggtcaagaaatgcttagaactatttactgaactagcagaagataaa
gagaactacaaaaagttttatgagcagttctcaaaaaatataaagcttggaattcatgaa
gactctcagaatcggaagaagctttcagagctgttgcggtactacacgtctgcttctggg
gatgagatggtttctctgaaggactactgcaccagaatgaaggaaaaccagaagcacatc
tattttatcacaggtgagaccaaggaccaggttgctaactcggcctttgtggaacgtctc
cgaaagcatggcttagaagtaatttatatgattgagcccattgatgagtattgtgtgcaa
cagctgaaggaatttgagggcaagaccttggtgtctgttaccaaagaaggactggaactt
ccagaagatgaggaggaaaagaagaaacaggaggagaaaaagacaaaatttgagaacctc
tgcaagattatgaaagatattttggagaagaaggttgaaaaggtggttgtgtcaaaccga
ttggtgacatccccatgctgtattgtcacaagcacgtatgggtggacagcaaacatggag
agaatcatgaaagctcaagccctcagagacaactcaacaatgggttacatggcagcaaag
aaacacctggagataaaccctgatcactccattattgaaaccttaaggcaaaaggcagag
gctgacaagaatgacaaatctgtgaaagatctggtcatcttgctgtatgaaactgcactc
ctgtcttccggcttcagtctggaagatccccagacccatgctaacaggatctacaggatg
atcaagcttggtctaggtattgatgaggatgaccctactgtggatgacaccagtgctgct
gtaactgaagaaatgcctcccctggaaggagacgacgacacatcgcgcatggaagaagta
gactaa

KEGG   Mus caroli (Ryukyu mouse): 110312679
Entry
110312679         CDS       T05910                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: heat shock protein HSP 90-alpha-like
  KO
K04079  molecular chaperone HtpG
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04141  Protein processing in endoplasmic reticulum
mcal04151  PI3K-Akt signaling pathway
mcal04217  Necroptosis
mcal04612  Antigen processing and presentation
mcal04621  NOD-like receptor signaling pathway
mcal04657  IL-17 signaling pathway
mcal04659  Th17 cell differentiation
mcal04914  Progesterone-mediated oocyte maturation
mcal04915  Estrogen signaling pathway
mcal05132  Salmonella infection
mcal05200  Pathways in cancer
mcal05215  Prostate cancer
mcal05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    110312679
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    110312679
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    110312679
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    110312679
   04612 Antigen processing and presentation
    110312679
   04659 Th17 cell differentiation
    110312679
   04657 IL-17 signaling pathway
    110312679
  09152 Endocrine system
   04915 Estrogen signaling pathway
    110312679
   04914 Progesterone-mediated oocyte maturation
    110312679
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110312679
  09162 Cancer: specific types
   05215 Prostate cancer
    110312679
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    110312679
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110312679
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mcal01009]
    110312679
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:mcal03110]
    110312679
   04131 Membrane trafficking [BR:mcal04131]
    110312679
   03051 Proteasome [BR:mcal03051]
    110312679
   03029 Mitochondrial biogenesis [BR:mcal03029]
    110312679
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcal04147]
    110312679
Protein phosphatases and associated proteins [BR:mcal01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     110312679
Chaperones and folding catalysts [BR:mcal03110]
 Heat shock proteins
  HSP90
   110312679
Membrane trafficking [BR:mcal04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    110312679
Proteasome [BR:mcal03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    110312679
Mitochondrial biogenesis [BR:mcal03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Parkin-independent mechanism factors
    110312679
Exosome [BR:mcal04147]
 Exosomal proteins
  Proteins found in most exosomes
   110312679
SSDB
Motif
Pfam: HSP90 HATPase_c HATPase_c_3 Zip FRQ
Other DBs
NCBI-GeneID: 110312679
NCBI-ProteinID: XP_021042144
UniProt: A0A6P5RG99
LinkDB
Position
17
AA seq 718 aa
MPEETQTQDQPMEEEEVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDALDKIR
YKSLTDPSKLDSGKELHINLIPSKQHXTLTIVDTGIGMTKADLINNLGTIAKSGTKAFME
ALQAGADISMIGQFGVGFYSAYLVAEKVTVITKHNDNEQYAWESSAGESFTVRTDTGELM
GRGTKVILHLKEDQTEYLEERRIKEIMKKHSQFIGYPITLFVEKERDKEVSDDEAEEKEE
KEEEKEKEEKESDDKPEIEDVGSDEEEEEKKDGDKKKKKKIKEKYIDQEELNKTKPIWMR
NPDDITNEEYGEFYKSLTNDWEEHLAVKHFSVEGQLEFRALLFVPRXAPFDLFENRKKKN
NIKLYVRRVFIMDNCEELIPEYLNFIRGVVDSEDLPLNISXEMLQQXKILKVIRKNLVKK
CLELFTELAEDKENYKKFYEQFSKNIKLGIHEDSQNRKKLSELLRYYTSASGDEMVSLKD
YCTRMKENQKHIYFITGETKDQVANSAFVERLRKHGLEVIYMIEAIDEYCVQQLKEFEGK
TLVSVTKEGLELPEDEEEKKKQXEKKTKFENLCKIMKDILEKKVEKVVVSNRLVTSPCCI
VTSTYGXTANMXRIMKAQALRDNSTMGYMAAKKHLEINPDHSIIETLRQKAEADKNDKSV
XDLVILLXETALLSSGFSLEDPQTHANRIYRMIKLGLGIDEDDPTADDTSAAVXEEMP
NT seq 2154 nt   +upstreamnt  +downstreamnt
atgcctgaggaaacccagacccaagaccaaccaatggaggaggaggaggtcgagaccttt
gcctttcaggcagaaattgcccagttaatgtccttgatcatcaataccttctactcgaac
aaagagatctttctgagggagctcatctccaattcatcggacgctctggataaaatccga
tacaagagcctgacggaccccagtaaactggactcagggaaggagctgcacatcaatctc
attcccagcaaacagcactgaaccctgacgattgtggatactggaattggaatgaccaag
gccgacttgatcaataaccttggcaccattgccaagtcgggcaccaaagccttcatggag
gctttgcaggctggtgcagatatctctatgattggccagtttggtgttggtttttactct
gcatatttggttgctgagaaagtgactgtcatcaccaagcataacgacaatgagcagtat
gcctgggagtcctcagctggggaatccttcacagtgaggactgacacaggtgaactaatg
ggtcgtggaacaaaggttatcttgcatctgaaagaagaccaaactgagtatttggaggaa
aggagaataaaggagatcatgaagaagcattctcagttcattggctatcccattactctc
tttgtggagaaggaacgagataaggaagtcagtgatgatgaggctgaagaaaaggaagag
aaagaggaagagaaagaaaaagaagaaaaggagtctgatgataaacctgaaatagaagat
gttggttctgatgaagaagaggaggagaagaaggatggtgacaaaaagaaaaagaagaag
ataaaggaaaagtacattgatcaagaagaactcaacaaaacaaagccgatttggatgaga
aatcctgatgacatcactaatgaggaatatggagagttctacaagagcttaaccaacgat
tgggaagaacatttggcagtaaagcatttttctgttgaaggacaattagaattccgggcc
cttctttttgtcccaagacncgctccttttgatctgtttgaaaacagaaagaagaagaac
aacatcaagttgtatgttcgcagagttttcatcatggataactgcgaggagctaatcccg
gagtatctgaatttcattagaggggtagtggattctgaggatctccctctaaatatttcc
ngtgaaatgctgcaacaaagnaaaattctgaaagttatcagaaagaatttggtcaagaaa
tgcttagaactatttactgaactagcagaagataaagagaactacaaaaagttttatgag
cagttctcaaaaaatataaagcttggaattcatgaagactctcagaatcggaagaagctt
tcagagctgttgcggtactacacgtctgcttctggggatgagatggtttctctgaaggac
tactgcaccagaatgaaggaaaaccagaagcacatctattttatcacaggtgagaccaag
gaccaggttgctaactcggcctttgtggaacgtctccgaaagcatggcttagaagtaatc
tatatgattgaggccattgatgagtattgtgtgcaacagctgaaggaatttgagggcaag
accttggtgtctgttaccaaagaaggactggaacttccagaagatgaggaggaaaagaag
aaacaggangagaaaaagacaaaatttgagaacctctgcaaaattatgaaagatattttg
gagaagaaggttgaaaaggtggttgtgtcaaaccgattggtgacatccccntgctgtatt
gtcacaagcacgtatgggtngacagcaaacatgganagaatcatgaaagctcaagccctc
agagacaactcaacaatgggttacatggcagcaaagaaacacctggagataaaccctgat
cactccattattgaaaccttaaggcaaaaggcagaggctgacaagaatgacaaatctgtg
aangatctggtcatcttgctgtangaaactgcactcctgtcttccggcttcagtctggaa
gatccccagacccatgctaacaggatctacaggatgatcaagcttggtctaggtattgat
gaggatgatcctactgcggatgacaccagtgctgctgtaantgaagaaatgcct

DBGET integrated database retrieval system