KEGG   Mus caroli (Ryukyu mouse): 110283660
Entry
110283660         CDS       T05910                                 

Gene name
Bak1
Definition
(RefSeq) bcl-2 homologous antagonist/killer
  KO
K14021  Bcl-2 homologous antagonist/killer
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal01524  Platinum drug resistance
mcal04141  Protein processing in endoplasmic reticulum
mcal04210  Apoptosis
mcal04215  Apoptosis - multiple species
mcal05022  Pathways of neurodegeneration - multiple diseases
mcal05132  Salmonella infection
mcal05160  Hepatitis C
mcal05162  Measles
mcal05163  Human cytomegalovirus infection
mcal05164  Influenza A
mcal05165  Human papillomavirus infection
mcal05167  Kaposi sarcoma-associated herpesvirus infection
mcal05168  Herpes simplex virus 1 infection
mcal05169  Epstein-Barr virus infection
mcal05170  Human immunodeficiency virus 1 infection
mcal05200  Pathways in cancer
mcal05202  Transcriptional misregulation in cancer
mcal05203  Viral carcinogenesis
mcal05206  MicroRNAs in cancer
mcal05210  Colorectal cancer
mcal05212  Pancreatic cancer
mcal05213  Endometrial cancer
mcal05214  Glioma
mcal05216  Thyroid cancer
mcal05217  Basal cell carcinoma
mcal05218  Melanoma
mcal05220  Chronic myeloid leukemia
mcal05222  Small cell lung cancer
mcal05223  Non-small cell lung cancer
mcal05224  Breast cancer
mcal05225  Hepatocellular carcinoma
mcal05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    110283660 (Bak1)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    110283660 (Bak1)
   04215 Apoptosis - multiple species
    110283660 (Bak1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110283660 (Bak1)
   05202 Transcriptional misregulation in cancer
    110283660 (Bak1)
   05206 MicroRNAs in cancer
    110283660 (Bak1)
   05203 Viral carcinogenesis
    110283660 (Bak1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110283660 (Bak1)
   05212 Pancreatic cancer
    110283660 (Bak1)
   05225 Hepatocellular carcinoma
    110283660 (Bak1)
   05226 Gastric cancer
    110283660 (Bak1)
   05214 Glioma
    110283660 (Bak1)
   05216 Thyroid cancer
    110283660 (Bak1)
   05220 Chronic myeloid leukemia
    110283660 (Bak1)
   05217 Basal cell carcinoma
    110283660 (Bak1)
   05218 Melanoma
    110283660 (Bak1)
   05213 Endometrial cancer
    110283660 (Bak1)
   05224 Breast cancer
    110283660 (Bak1)
   05222 Small cell lung cancer
    110283660 (Bak1)
   05223 Non-small cell lung cancer
    110283660 (Bak1)
  09164 Neurodegenerative disease
   05022 Pathways of neurodegeneration - multiple diseases
    110283660 (Bak1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110283660 (Bak1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    110283660 (Bak1)
   05160 Hepatitis C
    110283660 (Bak1)
   05164 Influenza A
    110283660 (Bak1)
   05162 Measles
    110283660 (Bak1)
   05168 Herpes simplex virus 1 infection
    110283660 (Bak1)
   05163 Human cytomegalovirus infection
    110283660 (Bak1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110283660 (Bak1)
   05169 Epstein-Barr virus infection
    110283660 (Bak1)
   05165 Human papillomavirus infection
    110283660 (Bak1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    110283660 (Bak1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:mcal03029]
    110283660 (Bak1)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mcal02000]
    110283660 (Bak1)
Mitochondrial biogenesis [BR:mcal03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    110283660 (Bak1)
Transporters [BR:mcal02000]
 Other transporters
  Pores ion channels [TC:1]
   110283660 (Bak1)
SSDB
Motif
Pfam: Bcl-2
Other DBs
NCBI-GeneID: 110283660
NCBI-ProteinID: XP_021004733
Ensembl: MGP_CAROLIEiJ_G0021294
UniProt: A0A6P5NVC8
LinkDB
Position
17
AA seq 209 aa
MASGQGPGPPKEGCDESPSPSEQQVAQDTEEVFRSYVFYLHQQEQETQGAAAPANPEMDN
LPLEPNSILGQVGRQLALIGDDINRRYDTEFQNLLEQLQPTAGNAYELFTKIASSLFKSG
ISWGRVVALLGFGYRLALYVYQRGLTGFLGQVTCFLADIILHHYIARWIAQRGGWVAALN
LRRDPILTVMVIFGVVLLGQFVVHRFFRS
NT seq 630 nt   +upstreamnt  +downstreamnt
atggcatctggacaaggaccaggtcctccgaaggagggctgcgatgagtccccgtcccct
tctgaacagcaggttgcccaggacacagaggaggtctttcgaagctacgttttttacctc
caccaacaggaacaggagacccagggggcggccgcccctgccaaccctgagatggacaac
ttgcccctggaacccaacagcatcttgggtcaggtgggtcggcagcttgctctcatcgga
gatgatattaaccggcgctacgacacagagttccagaatttactagaacagcttcagccc
acagccgggaatgcctacgaactcttcaccaagatcgcctccagcctatttaagagcggc
atcagctggggccgcgtggtggctctcctgggctttggctaccgtctggccctgtacgtc
taccagcgtggtttgaccggcttcctgggccaggtgacctgttttttggctgatatcata
ctgcatcattacatcgccagatggatcgcgcagagaggcggttgggtggcagccctgaat
ttgcgtagagaccccatcctgaccgtaatggtgatttttggtgtggttctgttgggccaa
ttcgtggtacacagattcttcagatcatga

DBGET integrated database retrieval system