KEGG   Mus caroli (Ryukyu mouse): 110283679
Entry
110283679         CDS       T05910                                 

Gene name
Cdkn1a
Definition
(RefSeq) cyclin-dependent kinase inhibitor 1
  KO
K06625  cyclin-dependent kinase inhibitor 1A
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal01522  Endocrine resistance
mcal01524  Platinum drug resistance
mcal04012  ErbB signaling pathway
mcal04066  HIF-1 signaling pathway
mcal04068  FoxO signaling pathway
mcal04110  Cell cycle
mcal04115  p53 signaling pathway
mcal04151  PI3K-Akt signaling pathway
mcal04218  Cellular senescence
mcal04630  JAK-STAT signaling pathway
mcal04921  Oxytocin signaling pathway
mcal04928  Parathyroid hormone synthesis, secretion and action
mcal04934  Cushing syndrome
mcal05160  Hepatitis C
mcal05161  Hepatitis B
mcal05163  Human cytomegalovirus infection
mcal05165  Human papillomavirus infection
mcal05166  Human T-cell leukemia virus 1 infection
mcal05167  Kaposi sarcoma-associated herpesvirus infection
mcal05169  Epstein-Barr virus infection
mcal05200  Pathways in cancer
mcal05202  Transcriptional misregulation in cancer
mcal05203  Viral carcinogenesis
mcal05205  Proteoglycans in cancer
mcal05206  MicroRNAs in cancer
mcal05210  Colorectal cancer
mcal05211  Renal cell carcinoma
mcal05212  Pancreatic cancer
mcal05213  Endometrial cancer
mcal05214  Glioma
mcal05215  Prostate cancer
mcal05216  Thyroid cancer
mcal05217  Basal cell carcinoma
mcal05218  Melanoma
mcal05219  Bladder cancer
mcal05220  Chronic myeloid leukemia
mcal05222  Small cell lung cancer
mcal05223  Non-small cell lung cancer
mcal05224  Breast cancer
mcal05225  Hepatocellular carcinoma
mcal05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    110283679 (Cdkn1a)
   04630 JAK-STAT signaling pathway
    110283679 (Cdkn1a)
   04066 HIF-1 signaling pathway
    110283679 (Cdkn1a)
   04068 FoxO signaling pathway
    110283679 (Cdkn1a)
   04151 PI3K-Akt signaling pathway
    110283679 (Cdkn1a)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    110283679 (Cdkn1a)
   04115 p53 signaling pathway
    110283679 (Cdkn1a)
   04218 Cellular senescence
    110283679 (Cdkn1a)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    110283679 (Cdkn1a)
   04928 Parathyroid hormone synthesis, secretion and action
    110283679 (Cdkn1a)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110283679 (Cdkn1a)
   05202 Transcriptional misregulation in cancer
    110283679 (Cdkn1a)
   05206 MicroRNAs in cancer
    110283679 (Cdkn1a)
   05205 Proteoglycans in cancer
    110283679 (Cdkn1a)
   05203 Viral carcinogenesis
    110283679 (Cdkn1a)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110283679 (Cdkn1a)
   05212 Pancreatic cancer
    110283679 (Cdkn1a)
   05225 Hepatocellular carcinoma
    110283679 (Cdkn1a)
   05226 Gastric cancer
    110283679 (Cdkn1a)
   05214 Glioma
    110283679 (Cdkn1a)
   05216 Thyroid cancer
    110283679 (Cdkn1a)
   05220 Chronic myeloid leukemia
    110283679 (Cdkn1a)
   05217 Basal cell carcinoma
    110283679 (Cdkn1a)
   05218 Melanoma
    110283679 (Cdkn1a)
   05211 Renal cell carcinoma
    110283679 (Cdkn1a)
   05219 Bladder cancer
    110283679 (Cdkn1a)
   05215 Prostate cancer
    110283679 (Cdkn1a)
   05213 Endometrial cancer
    110283679 (Cdkn1a)
   05224 Breast cancer
    110283679 (Cdkn1a)
   05222 Small cell lung cancer
    110283679 (Cdkn1a)
   05223 Non-small cell lung cancer
    110283679 (Cdkn1a)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110283679 (Cdkn1a)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110283679 (Cdkn1a)
   05161 Hepatitis B
    110283679 (Cdkn1a)
   05160 Hepatitis C
    110283679 (Cdkn1a)
   05163 Human cytomegalovirus infection
    110283679 (Cdkn1a)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110283679 (Cdkn1a)
   05169 Epstein-Barr virus infection
    110283679 (Cdkn1a)
   05165 Human papillomavirus infection
    110283679 (Cdkn1a)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    110283679 (Cdkn1a)
   01522 Endocrine resistance
    110283679 (Cdkn1a)
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 110283679
NCBI-ProteinID: XP_021004760
Ensembl: MGP_CAROLIEiJ_G0021337
LinkDB
Position
17
AA seq 159 aa
MSNPGDVRPVPHRSKVCRCLFGPVDSEQLRRDCDALMAGCLQEARERWNFDFITETPLEG
NFVWERVRSLGLPKVYLSPGSRGHDDLGGDKRPSTSSALLQGPAPEDHVALSLSCTLVSE
RPEDSPGGPGTSQGRKRRQTSLTDFYHSKRRLVFSKRKP
NT seq 480 nt   +upstreamnt  +downstreamnt
atgtccaatcctggtgatgtccgacctgttccgcacaggagcaaagtgtgccgttgtctc
ttcggtcccgtggacagtgagcagttgcgccgcgattgcgatgcgctcatggcgggctgt
ctccaggaggcccgagaaaggtggaactttgacttcatcacggagacgccgctggagggc
aacttcgtctgggagcgcgttcggagcctagggctgcccaaggtctacctaagccctggg
tcccgcggccatgacgacctgggaggggacaagaggcccagtacttcctctgccctgctg
caggggccagctccggaggaccacgtggccttgtcgctgtcttgcactctggtgtctgag
cggcctgaagattcccctggtgggcccggaacatctcagggccgaaaacggaggcagacc
agcctgacagatttctatcactccaagcgcagattggtgttctccaagagaaaaccctga

DBGET integrated database retrieval system