KEGG   Mus caroli (Ryukyu mouse): 110283766
Entry
110283766         CDS       T05910                                 

Gene name
Elob
Definition
(RefSeq) elongin-B
  KO
K03873  elongin-B
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04066  HIF-1 signaling pathway
mcal04120  Ubiquitin mediated proteolysis
mcal05170  Human immunodeficiency virus 1 infection
mcal05200  Pathways in cancer
mcal05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    110283766 (Elob)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    110283766 (Elob)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110283766 (Elob)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    110283766 (Elob)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    110283766 (Elob)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mcal04121]
    110283766 (Elob)
   03400 DNA repair and recombination proteins [BR:mcal03400]
    110283766 (Elob)
Ubiquitin system [BR:mcal04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECV complex
    Adoptor protein
     110283766 (Elob)
   ECS complex
     110283766 (Elob)
DNA repair and recombination proteins [BR:mcal03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    Other NER factors
     110283766 (Elob)
SSDB
Motif
Pfam: ubiquitin Rad60-SLD
Other DBs
NCBI-GeneID: 110283766
NCBI-ProteinID: XP_021004903
Ensembl: MGP_CAROLIEiJ_G0021162
UniProt: A0A6P5NYR4
LinkDB
Position
17
AA seq 118 aa
MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPEEQRLYKDDQLLDDGKTLGEC
GFTSQTARPQAPATVGLAFRADDTFEALRIEPFSSPPELPDVMKPQDSGGSANEQAVQ
NT seq 357 nt   +upstreamnt  +downstreamnt
atggacgtgtttctcatgatccggcgccacaagaccaccatctttacggacgccaaggag
tcgagcaccgtgttcgaactgaagcgcatcgtcgagggcatcctcaagcggccgccggag
gagcagcggctttacaaggatgaccagctccttgatgatggcaaaactctgggcgagtgt
ggcttcactagccagacagcacggccacaggccccagccacagtgggcctggccttccga
gcagatgacaccttcgaagctctccgcattgagcccttctccagccctccagagcttcca
gatgtgatgaagccacaggattctggaggcagtgccaatgaacaagctgtgcagtga

KEGG   Mus caroli (Ryukyu mouse): 110302142
Entry
110302142         CDS       T05910                                 

Definition
(RefSeq) elongin-B
  KO
K03873  elongin-B
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04066  HIF-1 signaling pathway
mcal04120  Ubiquitin mediated proteolysis
mcal05170  Human immunodeficiency virus 1 infection
mcal05200  Pathways in cancer
mcal05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    110302142
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    110302142
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110302142
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    110302142
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    110302142
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mcal04121]
    110302142
   03400 DNA repair and recombination proteins [BR:mcal03400]
    110302142
Ubiquitin system [BR:mcal04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECV complex
    Adoptor protein
     110302142
   ECS complex
     110302142
DNA repair and recombination proteins [BR:mcal03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    Other NER factors
     110302142
SSDB
Motif
Pfam: ubiquitin Rad60-SLD
Other DBs
NCBI-GeneID: 110302142
NCBI-ProteinID: XP_021028602
UniProt: A0A6P5NYR4
LinkDB
Position
1
AA seq 118 aa
MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPEEQRLYKDDQLLDDGKTLGEC
GFTSQTARPQAPATVGLAFRADDTFEALRIEPFSSPPELPDVMKPQDSGGSANEQAVQ
NT seq 357 nt   +upstreamnt  +downstreamnt
atggacgtgtttctcatgatccggcgccacaagaccaccatttttacggacgccaaggag
tcgagcaccgtgttcgaactgaagcgcatagtcgagggcatcctcaagcggcctccggag
gagcagcggctttacaaggatgaccagctccttgatgatggcaaaactctgggcgagtgt
ggcttcactagccagacagcacggccacaggccccagccacagtgggcctggccttccga
gcagatgacaccttcgaagctctccgcattgagcccttctccagccctccagaacttcca
gatgtgatgaagccacaggattctggaggcagtgccaatgaacaagctgtgcagtga

DBGET integrated database retrieval system